CC Chemokine Receptor D6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88150

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CC Chemokine Receptor D6 Antibody - BSA Free

CC Chemokine Receptor D6 Antibody - BSA Free Immunohistochemistry-Paraffin: CC Chemokine Receptor D6 Antibody - BSA Free [NBP1-88150]

Immunohistochemistry-Paraffin: CC Chemokine Receptor D6 Antibody - BSA Free [NBP1-88150]

Analysis in human placenta and skeletal muscle tissues using HPA013819 antibody. Corresponding ACKR2 RNA-seq data are presented for the same tissues.
CC Chemokine Receptor D6 Antibody - BSA Free Immunohistochemistry-Paraffin: CC Chemokine Receptor D6 Antibody - BSA Free [NBP1-88150]

Immunohistochemistry-Paraffin: CC Chemokine Receptor D6 Antibody - BSA Free [NBP1-88150]

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
CC Chemokine Receptor D6 Antibody - BSA Free Immunohistochemistry-Paraffin: CC Chemokine Receptor D6 Antibody - BSA Free [NBP1-88150]

Immunohistochemistry-Paraffin: CC Chemokine Receptor D6 Antibody - BSA Free [NBP1-88150]

Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
CC Chemokine Receptor D6 Antibody - BSA Free Immunohistochemistry-Paraffin: CC Chemokine Receptor D6 Antibody - BSA Free [NBP1-88150]

Immunohistochemistry-Paraffin: CC Chemokine Receptor D6 Antibody - BSA Free [NBP1-88150]

Staining of human rectum shows weak cytoplasmic positivity in glandular cells.
CC Chemokine Receptor D6 Antibody - BSA Free Immunohistochemistry-Paraffin: CC Chemokine Receptor D6 Antibody - BSA Free [NBP1-88150]

Immunohistochemistry-Paraffin: CC Chemokine Receptor D6 Antibody - BSA Free [NBP1-88150]

Staining of human fallopian tube shows strong positivity in cilia in glandular cells.

Applications for CC Chemokine Receptor D6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CC Chemokine Receptor D6

Chemokine Receptor D6 encodes a beta chemokine receptor similar to G protein-coupled receptors. Chemokines and their receptor-mediated signal transduction are critical for the recruitment of effector immune cells to the inflammation site. This receptor appears to bind the majority of beta-chemokine family members; however, its specific function remains unknown.

Long Name

Chemokine Binding Protein 2

Alternate Names

ACKR2, CCBP2, CMKBR9

Gene Symbol

ACKR2

Additional CC Chemokine Receptor D6 Products

Product Documents for CC Chemokine Receptor D6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CC Chemokine Receptor D6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for CC Chemokine Receptor D6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CC Chemokine Receptor D6 Antibody - BSA Free and earn rewards!

Have you used CC Chemokine Receptor D6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies