CCL18/PARC Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79940

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human CCL18. Peptide sequence PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CCL18/PARC Antibody - BSA Free

Western Blot: CCL18/PARC Antibody [NBP1-79940]

Western Blot: CCL18/PARC Antibody [NBP1-79940]

Western Blot: CCL18/PARC Antibody [NBP1-79940] - Host: Rabbit. Target Name: CCL18. Sample Tissue: Human HT1080 Whole Cell. Antibody Dilution: 1ug/ml
Immunohistochemistry-Paraffin: CCL18/PARC Antibody [NBP1-79940]

Immunohistochemistry-Paraffin: CCL18/PARC Antibody [NBP1-79940]

Immunohistochemistry-Paraffin: CCL18/PARC Antibody [NBP1-79940] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.
Western Blot: CCL18/PARC Antibody [NBP1-79940]

Western Blot: CCL18/PARC Antibody [NBP1-79940]

Western Blot: CCL18/PARC Antibody [NBP1-79940] - Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.
Western Blot: CCL18/PARC Antibody [NBP1-79940]

Western Blot: CCL18/PARC Antibody [NBP1-79940]

Western Blot: CCL18/PARC Antibody [NBP1-79940] - Fetal Lung lysates, Antibody Dilution: 0.5 ug/ml.
Western Blot: CCL18/PARC Antibody [NBP1-79940]

Western Blot: CCL18/PARC Antibody [NBP1-79940]

Western Blot: CCL18/PARC Antibody [NBP1-79940] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
Western Blot: CCL18/PARC Antibody [NBP1-79940]

Western Blot: CCL18/PARC Antibody [NBP1-79940]

Western Blot: CCL18/PARC Antibody [NBP1-79940] - Host: Rabbit. Target: CCL18. Positive control (+): Human lung (LU). Negative control (-): HepG2 (HG). Antibody concentration: 1ug/ml

Applications for CCL18/PARC Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CCL18/PARC

CCL18 - chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated)

Alternate Names

AMAC-1, DC-CK1, MIP-4, PARC

Gene Symbol

CCL18

Additional CCL18/PARC Products

Product Documents for CCL18/PARC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CCL18/PARC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CCL18/PARC Antibody - BSA Free

Customer Reviews for CCL18/PARC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CCL18/PARC Antibody - BSA Free and earn rewards!

Have you used CCL18/PARC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCL18/PARC Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: One customer is interested in that Ab: Macrophage Inflammatory Protein 4 Antibody - NBP1-79940 Please, I will be very grateful if you indicate me: - The concentration of the current lot. - Do you have previously news about the use of this Ab in IHC-P with human lung and arterial tissue samples?. Also, any recent bibliographic publication?. - Which other positive control, apart intestinal tissue, you recommend for IHC-P?. - Which detection system you recommend for IHC-P for that Ab?, which is it the exactlly one that you have employed at the image the image that you have at the data sheet?-

    A: Thank you very much for your kind note and for sharing your customer's query on our Macrophage Inflammatory Protein 4 antibody (NBP1-79940). The point wise answer to your query is as follows: Q1. The concentration of the current lot. Answer: This product is sold in its lyophilized form and the concentration will not be relevant to the vial. The unit size is 0.05 mg and the customer can reconstitute the vial as: centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50ul of distilled water. Vortex followed by centrifuge again to pellet the solution. Final concentration is 1 mg/ml in PBS buffer. Q2. Do you have previously news about the use of this Ab in IHC-P with human lung and arterial tissue samples?. Also, any recent bibliographic publication?. Answer: No, we do not know of anyone citing this product yet, and we do not have any customer feedback on your mentioned tissues. Lung is one of the tissues where this target is expressed well, and we are confident that the antibody will detect the protein in lung sections. Q3. Which other positive control, apart intestinal tissue, you recommend for IHC-P?. Answer: From Uniprot, we can see that lung, lymph nodes, placenta or bone marrow would be of great choice as positive controls. Further, the customer may look at the following papers to see how other researchers performed Macrophage Inflammatory Protein 4 (CCL18) staining in different tissues: PMID 24011266, PMID 23433718, and PMID 11590198. Q4. Which detection system you recommend for IHC-P for that Ab?, which is it the exactlly one that you have employed at the image the image that you have at the data sheet? Answer: DAB based detection system was used for the final development of the staining.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies