CCR7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58753

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Single Cell Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFS

Reactivity Notes

Mouse 83%, Rat 85%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CCR7 Antibody - BSA Free (NBP2-58753) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CCR7 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CCR7 Antibody [NBP2-58753]

Immunocytochemistry/ Immunofluorescence: CCR7 Antibody [NBP2-58753]

Immunocytochemistry/Immunofluorescence: CCR7 Antibody [NBP2-58753] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Applications for CCR7 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CCR7

Chemokine receptor 7 (CCR7) is a G-protein coupled receptor (GPCR) that binds chemokine ligand 19 (CCL19) and chemokine ligand 21 (CCL21) and, together, this receptor-ligand interaction functions in inflammatory and adaptive immune response (1,2). The CCR7 protein contains 7-transmembrane spanning alpha helices and is 378 amino acids (aa) in length, with a theoretical molecular weight of 42.8 kDa (3,4). CCR7 is expressed on several cells within the immune system, including naive T cells, central memory T cells, regulatory T cells, naive B cells, a subset of double negative and single positive thymocytes, and mature dendritic cells (DCs) (1, 3).

The primary role of the CCR7/CCL19/CCL21 chemokine signaling axis is homing T cells and DCs to lymph nodes and lymphoid tissues to initiate an immune response (1,2,5,6). In the context of cancer, the CCR7 signaling axis appears to have two opposing roles (2). Downregulation of CCR7 on CD8+ T cells contributes to effector cell migration and anti-cancer activities via cytotoxic tumor-infiltrating lymphocytes (2). However, upregulation of CCR7 by cancer cells can result in cancer cell migration and metastasis (2). Overexpression of CCR7 has been implicated in a variety of cancers including breast, cervical, gastric, head and neck cell carcinoma, and prostate (1,2,7). Studies in breast cancer have found that hypoxia increases CCR7 expression, and this activation can affect cancer cell invasion, extravasation, proliferation, angiogenesis, and metastasis through induction of multiple signaling transduction pathways such as PI3K/AKT, MAPK, and JAK/STAT (5,7).

Given its important role in inflammation and immune response, several strategies have been employed to target the CCR7 signaling axis for cancer immunotherapy (2). Some cancer immunotherapies under investigation include intra-tumoral administration of CCL19 and CCL21, introduction of patient-derived cells transfected to express CCR7 or its ligands, and vaccines (2). Further interrogation of CCR7/CCL19/CCL21 signaling axis is required to develop better therapeutic strategies for cancer treatment.

References:

1. Comerford, I., Harata-Lee, Y., Bunting, M. D., Gregor, C., Kara, E. E., & McColl, S. R. (2013). A myriad of functions and complex regulation of the CCR7/CCL19/CCL21 chemokine axis in the adaptive immune system. Cytokine & growth factor reviews, 24(3), 269-283. https://doi.org/10.1016/j.cytogfr.2013.03.001

2. Salem, A., Alotaibi, M., Mroueh, R., Basheer, H. A., & Afarinkia, K. (2021). CCR7 as a therapeutic target in Cancer. Biochimica et biophysica acta. Reviews on cancer, 1875(1), 188499. https://doi.org/10.1016/j.bbcan.2020.188499

3. Yan, Y., Chen, R., Wang, X., Hu, K., Huang, L., Lu, M., & Hu, Q. (2019). CCL19 and CCR7 Expression, Signaling Pathways, and Adjuvant Functions in Viral Infection and Prevention. Frontiers in cell and developmental biology, 7, 212. https://doi.org/10.3389/fcell.2019.00212

4. Uniprot (P32248)

5. Korbecki, J., Grochans, S., Gutowska, I., Barczak, K., & Baranowska-Bosiacka, I. (2020). CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of Receptors CCR5, CCR6, CCR7, CCR8, CCR9, and CCR10 Ligands. International journal of molecular sciences, 21(20), 7619. https://doi.org/10.3390/ijms21207619

6. Sanchez-Sanchez, N., Riol-Blanco, L., & Rodriguez-Fernandez, J. L. (2006). The multiple personalities of the chemokine receptor CCR7 in dendritic cells. Journal of immunology (Baltimore, Md. : 1950), 176(9), 5153-5159. https://doi.org/10.4049/jimmunol.176.9.5153

7. Rizeq, B., & Malki, M. I. (2020). The Role of CCL21/CCR7 Chemokine Axis in Breast Cancer Progression. Cancers, 12(4), 1036. https://doi.org/10.3390/cancers12041036

Alternate Names

BLR2, CC-CKR-7, CCR7, CD197, CDw197, CMKBR7, EBI1

Gene Symbol

CCR7

Additional CCR7 Products

Product Documents for CCR7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CCR7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCR7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CCR7 Antibody - BSA Free and earn rewards!

Have you used CCR7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies