Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Reactivity Notes
Mouse 80%, Rat 83%
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CD28 Antibody - BSA Free
Immunohistochemistry-Paraffin: CD28 Antibody [NBP2-57015]
Immunohistochemistry-Paraffin: CD28 Antibody [NBP2-57015] - Staining of human cerebral cortex shows no positivity in neuronal cells as expected.Immunohistochemistry-Paraffin: CD28 Antibody [NBP2-57015]
Immunohistochemistry-Paraffin: CD28 Antibody [NBP2-57015] - Staining of human liver shows no positivity in hepatocytes.Immunohistochemistry-Paraffin: CD28 Antibody [NBP2-57015]
Immunohistochemistry-Paraffin: CD28 Antibody [NBP2-57015] - Staining of human tonsil shows moderate membranous positivity in lymphocytes.Immunohistochemistry-Paraffin: CD28 Antibody [NBP2-57015]
Immunohistochemistry-Paraffin: CD28 Antibody [NBP2-57015] - Staining of human lymph node shows moderate membranous positivity in lymphocytes.Applications for CD28 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CD28
CD28 is the prototypical and best-characterized costimulatory molecule on T cells (4). Its signals are critical for optimal naive T cell activation, cytokine production, proliferation, and survival (4). In order to sustain T cell activation, CD28 will consolidate immunological synapse formation, increase cell cycle progression through upregulated D-cyclin expression, and aid in T cell survival by in inducing the expression of the anti-apoptotic protein Bcl-XL (5). CD28 is constitutively expressed on naive and central memory CD4+ and CD8+ cells (5). CD28 deficiency has a large impact on T cell responses including activation, proliferation, immunoglobulin (Ig) class-switching, and germinal center (GC) formation (6). CD28 is a critical regulator of autoimmune diseases and tolerance to solid organ transplants in human patients (6). The CD28 pathway plays a central role in immune responses against pathogens, autoimmune diseases, and graft rejection (7). CD28 engagement via antibodies augments the proliferation of T cells in response to immobilized anti-CD3 antibodies (8). Additionally, antibody engagement of CD28 can supply costimulation to T cells encountering APCs deficient in costimulatory ligands, such as CD80 and CD86, and prevents the resultant anergic state that otherwise occurs in the absence of costimulatory signaling (8).
References
1. Esensten, J. H., Helou, Y. A., Chopra, G., Weiss, A., & Bluestone, J. A. (2016). CD28 Costimulation: From Mechanism to Therapy. Immunity, 44(5), 973-988. https://doi.org/10.1016/j.immuni.2016.04.020
2. Carreno, B. M., & Collins, M. (2002). The B7 family of ligands and its receptors: new pathways for costimulation and inhibition of immune responses. Annual review of immunology, 20, 29-53. https://doi.org/10.1146/annurev.immunol.20.091101.091806
3. Ward S. G. (1996). CD28: a signaling perspective. The Biochemical journal, 318 (Pt 2), 361-377. https://doi.org/10.1042/bj3180361
4. Zhang, R., Huynh, A., Whitcher, G., Chang, J., Maltzman, J. S., & Turka, L. A. (2013). An obligate cell-intrinsic function for CD28 in Tregs. The Journal of clinical investigation, 123(2), 580-593. https://doi.org/10.1172/JCI65013
5. Evans, E. J., Esnouf, R. M., Manso-Sancho, R., Gilbert, R. J., James, J. R., Yu, C., Fennelly, J. A., Vowles, C., Hanke, T., Walse, B., Hunig, T., Sorensen, P., Stuart, D. I., & Davis, S. J. (2005). Crystal structure of a soluble CD28-Fab complex. Nature immunology, 6(3), 271-279. https://doi.org/10.1038/ni1170
6. Bour-Jordan, H., & Blueston, J. A. (2002). CD28 function: a balance of costimulatory and regulatory signals. Journal of clinical immunology, 22(1), 1-7. https://doi.org/10.1023/a:1014256417651
7. Krummel, M. F., & Allison, J. P. (1995). CD28 and CTLA-4 have opposing effects on the response of T cells to stimulation. The Journal of experimental medicine, 182(2), 459-465. https://doi.org/10.1084/jem.182.2.459
8. Luhder, F., Huang, Y., Dennehy, K. M., Guntermann, C., Muller, I., Winkler, E., Kerkau, T., Ikemizu, S., Davis, S. J., Hanke, T., & Hunig, T. (2003). Topological requirements and signaling properties of T cell-activating, anti-CD28 antibody superagonists. The Journal of experimental medicine, 197(8), 955-966. https://doi.org/10.1084/jem.20021024
Alternate Names
CD28
Gene Symbol
CD28
Additional CD28 Products
Product Documents for CD28 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CD28 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CD28 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CD28 Antibody - BSA Free and earn rewards!
Have you used CD28 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars