CD79B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88945

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CD79B Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CD79B Antibody - BSA Free (NBP1-88945) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CD79B Antibody - BSA Free

Western Blot: CD79B Antibody [NBP1-88945]

Western Blot: CD79B Antibody [NBP1-88945]

Western Blot: CD79B Antibody [NBP1-88945] - Analysis in control (vector only transfected HEK293T lysate) and CD79B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: CD79B Antibody [NBP1-88945]

Immunocytochemistry/ Immunofluorescence: CD79B Antibody [NBP1-88945]

Immunocytochemistry/Immunofluorescence: CD79B Antibody [NBP1-88945] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: CD79B Antibody [NBP1-88945]

Immunohistochemistry-Paraffin: CD79B Antibody [NBP1-88945]

Immunohistochemistry-Paraffin: CD79B Antibody [NBP1-88945] - Staining in human lymph node and cerebral cortex tissues using anti-CD79B antibody. Corresponding CD79B RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD79B Antibody [NBP1-88945]

Immunohistochemistry-Paraffin: CD79B Antibody [NBP1-88945]

Immunohistochemistry-Paraffin: CD79B Antibody [NBP1-88945] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra and weak to moderate in reaction center cells.
Immunohistochemistry-Paraffin: CD79B Antibody [NBP1-88945]

Immunohistochemistry-Paraffin: CD79B Antibody [NBP1-88945]

Immunohistochemistry-Paraffin: CD79B Antibody [NBP1-88945] - Staining of human cerebral cortex shows low expression as expected.

Applications for CD79B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD79B

Murine CD79 is a 23/21 kDa disulfide-linked heterodimer composed of an alpha chain (CD79alpha/mb-1) and a beta chain (CD79b/B29) that associates non-covalently with membrane immunoglobulin (Ig) to form the B cell receptor (BCR) complex. Its expression is restricted to B lymphocytes, first appearing on the surface at the pro-B cell stage prior to productive Ig gene rearrangements and remaining through all stages of B-cell differentiation prior to plasma cells. It has been proposed that the CD79 complex on pro-B cell surfaces may function to induce early B-cell differentiation. (1)

Alternate Names

B29, CD79B, IGB

Gene Symbol

CD79B

Additional CD79B Products

Product Documents for CD79B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CD79B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

B Cell Activation

Customer Reviews for CD79B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD79B Antibody - BSA Free and earn rewards!

Have you used CD79B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies