CDK20 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91214

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CDK20 Antibody - BSA Free

Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214]

Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214]

Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.
Western Blot: CDK20 Antibody [NBP1-91214]

Western Blot: CDK20 Antibody [NBP1-91214]

Western Blot: CDK20 Antibody [NBP1-91214] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214]

Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214]

Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214]

Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214]

Immunohistochemistry-Paraffin: CDK20 Antibody [NBP1-91214] - Staining of human duodenum shows weak cytoplasmic positivity in glandular cells.
CDK20 Antibody - BSA Free Western Blot: CDK20 Antibody - BSA Free [NBP1-91214]

Western Blot: CDK20 Antibody - BSA Free [NBP1-91214]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
CDK20 Antibody - BSA Free Immunohistochemistry: CDK20 Antibody - BSA Free [NBP1-91214]

Immunohistochemistry: CDK20 Antibody - BSA Free [NBP1-91214]

Analysis in human fallopian tube and skeletal muscle tissues using NBP1-91214 antibody. Corresponding CDK20 RNA-seq data are presented for the same tissues.
CDK20 Antibody - BSA Free Immunohistochemistry: CDK20 Antibody - BSA Free [NBP1-91214]

Immunohistochemistry: CDK20 Antibody - BSA Free [NBP1-91214]

Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
CDK20 Antibody - BSA Free Immunohistochemistry: CDK20 Antibody - BSA Free [NBP1-91214]

Immunohistochemistry: CDK20 Antibody - BSA Free [NBP1-91214]

Staining of human skeletal muscle shows no positivity in a subset of myocytes as expected.
CDK20 Antibody - BSA Free Western Blot: CDK20 Antibody - BSA Free [NBP1-91214]

Western Blot: CDK20 Antibody - BSA Free [NBP1-91214]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for CDK20 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDK20

CCRK is encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase activates CDK2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Long Name

Cyclin-dependent kinase 20

Alternate Names

CAK-kinase p42, CCRK, CDCH

Gene Symbol

CDK20

Additional CDK20 Products

Product Documents for CDK20 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDK20 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CDK20 Antibody - BSA Free

Customer Reviews for CDK20 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDK20 Antibody - BSA Free and earn rewards!

Have you used CDK20 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...