CEACAM5/CD66e Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85742

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CEACAM-5/CD66e Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CEACAM5/CD66e Antibody - BSA Free (NBP1-85742) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CEACAM5/CD66e Antibody - BSA Free

CEACAM5/CD66e Antibody - BSA Free

CEACAM5/CD66e Antibody [NBP1-85742] -

Staining of human cell line HaCaT shows localization to plasma membrane.
Western Blot: CEACAM5/CD66e Antibody [NBP1-85742]

Western Blot: CEACAM5/CD66e Antibody [NBP1-85742]

Western Blot: CEACAM5/CD66e Antibody [NBP1-85742] - Analysis in human colon tissue.
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742]

Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742]

Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742]

Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742]

Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742] - Staining of human colorectal cancer shows strong membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742]

Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742]

Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742] - Staining of human colon shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742]

Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742]

Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Applications for CEACAM5/CD66e Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 -1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CEACAM-5/CD66e

Carcino Embryonic Antigen (CEA) is synthesised during development in the fetal gut, and is re-expressed in increased amounts in intestinal carcinomas and several other tumors. Antibodies to CEA are useful in identifying the origin of various metastatic adenocarcinomas and in distinguishing pulmonary adenocarcinomas (60 to 70% are CEA+) from pleural mesotheliomas (rarely or weakly CEA+).

Long Name

Carcinoembryonic Antigen-related Cell Adhesion Molecule 5

Alternate Names

CD66e, CEA, CEACAM5

Entrez Gene IDs

1048 (Human)

Gene Symbol

CEACAM5

Additional CEACAM-5/CD66e Products

Product Documents for CEACAM5/CD66e Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CEACAM5/CD66e Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CEACAM5/CD66e Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CEACAM5/CD66e Antibody - BSA Free and earn rewards!

Have you used CEACAM5/CD66e Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies