CFTR Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-16990

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CFTR Antibody - BSA Free

Immunohistochemistry-Paraffin: CFTR Antibody [NBP3-16990]

Immunohistochemistry-Paraffin: CFTR Antibody [NBP3-16990]

Immunohistochemistry-Paraffin: CFTR Antibody [NBP3-16990] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: CFTR Antibody [NBP3-16990]

Immunohistochemistry-Paraffin: CFTR Antibody [NBP3-16990]

Immunohistochemistry-Paraffin: CFTR Antibody [NBP3-16990] - Analysis in human pancreas and lymph node tissues using Anti-CFTR antibody. Corresponding CFTR RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CFTR Antibody [NBP3-16990]

Immunohistochemistry-Paraffin: CFTR Antibody [NBP3-16990]

Immunohistochemistry-Paraffin: CFTR Antibody [NBP3-16990] - Staining of human pancreas shows high expression.

Applications for CFTR Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CFTR

Cystic fibrosis transmembrane conductance regulator (CFTR) is a multi-pass transmembrane protein that functions as a chloride channel. CFTR belongs to the ATP-binding cassette (ABC) superfamily. Mutations in CFTR cause the pulmonary disease, cystic fibrosis (CF). Specifically, deletion of phenyalanine at position 508 (DeltaF508-CFTR) results in a folding defect which impairs chloride channel function. The mechanism by which channel dysfunction relates to disease symptoms is a focus of intense research. CFTR dysfunction results in disruption of ion transport and subsequent blockage of airways by secreted mucus. CFTR may also play a role in the skeletal muscle atrophy and dysfunction that characterizes CF. In addition, CFTR-mediated chloride secretion underlies fluid accumulation and cyst growth in autosomal dominant polycystic kidney disease (ADPKD).

Long Name

Cystic Fibrosis Transmembrane Conductance Regulator

Alternate Names

ABC35, ABCC7CF, ATP-binding cassette sub-family C member 7, ATP-binding cassette transporter sub-family C member 7, cAMP-dependent chloride channel, CFTR/MRP, Channel conductance-controlling ATPase, cystic fibrosis transmembrane conductance regulator, cystic fibrosis transmembrane conductance regulator (ATP-binding cassettesub-family C, member 7), cystic fibrosis transmembrane conductance regulator, ATP-binding cassette(sub-family C, member 7), dJ760C5.1, EC 3.6.3, MRP7EC 3.6.3.49, TNR-CFTR

Gene Symbol

CFTR

Additional CFTR Products

Product Documents for CFTR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CFTR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CFTR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CFTR Antibody - BSA Free and earn rewards!

Have you used CFTR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies