CGI 62 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88246

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CGI 62 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CGI 62 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CGI 62 Antibody [NBP1-88246]

Immunocytochemistry/ Immunofluorescence: CGI 62 Antibody [NBP1-88246]

Immunocytochemistry/Immunofluorescence: CGI 62 Antibody [NBP1-88246] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: CGI 62 Antibody [NBP1-88246]

Immunohistochemistry-Paraffin: CGI 62 Antibody [NBP1-88246]

Immunohistochemistry-Paraffin: CGI 62 Antibody [NBP1-88246] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
CGI 62 Antibody - BSA Free Western Blot: CGI 62 Antibody - BSA Free [NBP1-88246]

Western Blot: CGI 62 Antibody - BSA Free [NBP1-88246]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
CGI 62 Antibody - BSA Free Western Blot: CGI 62 Antibody - BSA Free [NBP1-88246]

Western Blot: CGI 62 Antibody - BSA Free [NBP1-88246]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for CGI 62 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CGI 62

Alternate Names

C8orf70, CGI-62, chromosome 8 open reading frame 70, family with sequence similarity 164, member A, hypothetical protein LOC51101

Gene Symbol

ZC2HC1A

Additional CGI 62 Products

Product Documents for CGI 62 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CGI 62 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CGI 62 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CGI 62 Antibody - BSA Free and earn rewards!

Have you used CGI 62 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies