Catalog Number: 1087
Alternate Names: ChTx
Biological Activity
Specific inhibitor of the big conductance Ca2+-activated K+ channel.
Technical Data
  • M.Wt:
    4295.95
  • Formula:
    C176H277N57O55S7
  • Sequence:
    XFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS

    (Modifications: X-1 = Glp, Disulfide bridge between 7 - 28, 13 - 33,17 - 35, Ser-37 = C-terminal OH)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    95751-30-7
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Charybdotoxin-sensitive K+ channels regulate the myogenic tone in the resting state of arteries from spontaneously hypertensive rats.
    Asano et al.
    Br.J.Pharmacol., 1993;108:214
  2. Purification, sequence, and model structure of charybdotoxin, a potent selective inhibitor of calcium activated potassium channels.
    Gimenez-Gallego et al.
    Proc.Natl.Acad.Sci.U.S.A., 1988;85:3329
  3. Charybdotoxin, a protein inhibitor of single Ca2+ activated K+ channels from mammalian skeletal muscle.
    Miller et al.
    Nature, 1985;313:316
Citations:

Have you used Charybdotoxin?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information