CHIP/STUB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47510

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CHIP/STUB1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CHIP/STUB1 Antibody - BSA Free (NBP2-47510) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CHIP/STUB1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510]

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510]

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human adrenal gland, colon, gallbladder and kidney using Anti-STUB1 antibody NBP2-47510 (A) shows similar protein distribution across tissues to independent antibody NBP2-47509 (B).
Western Blot: CHIP/STUB1 Antibody [NBP2-47510]

Western Blot: CHIP/STUB1 Antibody [NBP2-47510]

Western Blot: CHIP/STUB1 Antibody [NBP2-47510] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human Analysis of tonsil tissue.
Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510]

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510]

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human gallbladder.
Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510]

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510]

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510]

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510]

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human kidney.
Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510]

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510]

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human colon.
Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510]

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510]

Immunohistochemistry-Paraffin: CHIP/STUB1 Antibody [NBP2-47510] - Staining of human adrenal gland.

Applications for CHIP/STUB1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHIP/STUB1

STUB1/CHIP is an E3 ubiquitin ligase and co-chaperone of heat-shock protein 70 (Hsp70). STUB1/CHIP interacts with Hsp70 to monitor protein folding and direct misfolded proteins for proteasomal degradation. It has been found to also associate with Hsp90 to remove phosphorylated protein tau, a protein that accumulates in the brains of Alzheimers and Down's syndrome patients. STUB1/CHIP has been reported to also have intrinsic chaperone activity and recognize non-native proteins in response to heat stress. In this way, STUB1/CHIP has been shown to be a direct chaperone for p53. Alternate names for STUB1/CHIP include carboxy terminus of Hsp70-interacting protein, STIP1 homology and U-box containing protein 1, CLL-associated antigen KW-8 antigen, serologically defined colon cancer antigen 7, heat shock protein A binding protein 2, NY-CO-7, HSPABP2, and SDCCAG7.

Long Name

C-terminus of Hsc70 Interacting Protein

Alternate Names

HSPABP2, NY-CO-7, SDCCAG7, STUB1, UBOX1

Gene Symbol

STUB1

Additional CHIP/STUB1 Products

Product Documents for CHIP/STUB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CHIP/STUB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHIP/STUB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHIP/STUB1 Antibody - BSA Free and earn rewards!

Have you used CHIP/STUB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies