Chromogranin A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86056

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Chromogranin A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22412953), Mouse reactivity reported in scientific literature (PMID: 24843046).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Chromogranin A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Chromogranin A Antibody [NBP1-86056]

Immunocytochemistry/ Immunofluorescence: Chromogranin A Antibody [NBP1-86056]

Immunocytochemistry/Immunofluorescence: Chromogranin A Antibody [NBP1-86056] - Staining of human cell line SH-SY5Y shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Chromogranin A Antibody [NBP1-86056]

Immunohistochemistry-Paraffin: Chromogranin A Antibody [NBP1-86056]

Immunohistochemistry-Paraffin: Chromogranin A Antibody [NBP1-86056] - Staining in human parathyroid gland and liver tissues using anti-CHGA antibody. Corresponding CHGA RNA-seq data are presented for the same tissues.
Chromogranin A Antibody - BSA Free Immunohistochemistry-Paraffin: Chromogranin A Antibody - BSA Free [NBP1-86056]

Immunohistochemistry-Paraffin: Chromogranin A Antibody - BSA Free [NBP1-86056]

Staining of human parathyroid gland shows strong membranous and cytoplasmic positivity in glandular cells.
Chromogranin A Antibody - BSA Free Immunohistochemistry-Paraffin: Chromogranin A Antibody - BSA Free [NBP1-86056]

Immunohistochemistry-Paraffin: Chromogranin A Antibody - BSA Free [NBP1-86056]

Staining of human liver shows no positivity in hepatocytes as expected.
Chromogranin A Antibody - BSA Free Immunohistochemistry-Paraffin: Chromogranin A Antibody - BSA Free [NBP1-86056]

Immunohistochemistry-Paraffin: Chromogranin A Antibody - BSA Free [NBP1-86056]

Staining of human duodenum shows strong cytoplasmic positivity in enteroendocrine cells.
Chromogranin A Antibody - BSA Free Immunohistochemistry-Paraffin: Chromogranin A Antibody - BSA Free [NBP1-86056]

Immunohistochemistry-Paraffin: Chromogranin A Antibody - BSA Free [NBP1-86056]

Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Chromogranin A Antibody - BSA Free Western Blot: Chromogranin A Antibody - BSA Free [NBP1-86056]

Western Blot: Chromogranin A Antibody - BSA Free [NBP1-86056]

Analysis in human plasma.

Applications for Chromogranin A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Chromogranin A

Chromogranin A (CgA) is an 86 kDa protein that is the major member of the granin family of acidic secretory glycoproteins located in neuroendocrine cells. CgA is believed to play a role in targeting peptide hormones and neurotransmitters to granules of the regulated pathways and inhibit hormone and neurotransmitter release. Also, the widespread distribution of CgA has made the measurement of circulating immunoreactive CgA a valuable tool in the diagnosis of neuroendocrine neoplasia, and CgA immunohistochemistry can help to identify the neuroendocrine nature of tumors. The N-terminal domain of CgA inhibits tumor necrosis factor a (TNFa) induced gap formation in human umbilical venous endothelial cells. CgA levels which reflect neuroendocrine differentiation of prostatic carcinoma may have a diagnostic, therapeutic and prognostic role in the management of prostate cancer patients.

Alternate Names

Betagranin, Catestatin, CHGA, Chromofungin, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I

Gene Symbol

CHGA

Additional Chromogranin A Products

Product Documents for Chromogranin A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Chromogranin A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Chromogranin A Antibody - BSA Free

Customer Reviews for Chromogranin A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Chromogranin A Antibody - BSA Free and earn rewards!

Have you used Chromogranin A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Chromogranin A Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I have following question about antibodies against Chromogranin A. Your products list the species but canine is not included. Does it mean that the products cannot be used on canine tissues?

    A:

    When we do not list a species, it means we have not tested an antibody to work with those samples. If we test an antibody and find that it does not work, we will list the species with a minus sign. Unfortunately, we haven't tried these abs on canine tissues and they may work, but we cannot guarantee it. If you would like to purchase one to try, you will be eligible for the Innovators Reward Program.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies