Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8)

Novus Biologicals | Catalog # NBP3-15389

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2O4P8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Chymase/CMA1/Mast Cell Chymase (CMA1) (P23946). GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8)

Western Blot: Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8) [NBP3-15389]

Western Blot: Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8) [NBP3-15389]

Western Blot: Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8) [NBP3-15389] - Analysis of extracts of various cell lines, using Chymase/CMA1/Mast Cell Chymase (CMA1) Rabbit mAb (NBP3-15389) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8) [NBP3-15389]

Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8) [NBP3-15389]

Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8) [NBP3-15389] - Human appendix using Chymase/CMA1/Mast Cell Chymase (CMA1) Rabbit mAb (NBP3-15389) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunohistochemistry

1:100 - 1:800

Immunohistochemistry-Paraffin

1:100 - 1:800

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Chymase/CMA1

Mast cells contain a number of preformed chemicals mediators such as histamine, chymase, carboxypeptidase and proteolytic tryptase. Human Mast Cell Chymase is considered to be an important marker of mast cells as well as an important mediator of inflammation.

Alternate Names

CMA1, CYH, MCP3P, Mcpt5, MCT1

Gene Symbol

CMA1

Additional Chymase/CMA1 Products

Product Documents for Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8)

There are currently no reviews for this product. Be the first to review Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8) and earn rewards!

Have you used Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...