CIP29 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88084

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAERFGIA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CIP29 Antibody - BSA Free

Western Blot: CIP29 Antibody [NBP1-88084]

Western Blot: CIP29 Antibody [NBP1-88084]

Western Blot: CIP29 Antibody [NBP1-88084] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: CIP29 Antibody [NBP1-88084]

Immunocytochemistry/ Immunofluorescence: CIP29 Antibody [NBP1-88084]

Immunocytochemistry/Immunofluorescence: CIP29 Antibody [NBP1-88084] - Staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: CIP29 Antibody [NBP1-88084]

Immunohistochemistry-Paraffin: CIP29 Antibody [NBP1-88084]

Immunohistochemistry-Paraffin: CIP29 Antibody [NBP1-88084] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
CIP29 Antibody - BSA Free Western Blot: CIP29 Antibody - BSA Free [NBP1-88084]

Western Blot: CIP29 Antibody - BSA Free [NBP1-88084]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Applications for CIP29 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CIP29

The CIP29 gene encodes a protein that is upregulated in response to various cytokines. The encoded protein may play a rolein cell cycle progression. A translocation between this gene and the myeloid/lymphoid leukemia gene, resulting inexpression of a chimeric

Alternate Names

CIP29Hcc-1, cytokine induced protein 29 kDa, Cytokine-induced protein of 29 kDa, HCC1MGC14726, hepatocellular carcinoma 1, HSPC316, Nuclear protein Hcc-1, proliferation associated cytokine-inducible protein CIP29, Proliferation-associated cytokine-inducible protein CIP29, SAP domain containing ribonucleoprotein, SAP domain-containing ribonucleoprotein, THO1

Gene Symbol

SARNP

Additional CIP29 Products

Product Documents for CIP29 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CIP29 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CIP29 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CIP29 Antibody - BSA Free and earn rewards!

Have you used CIP29 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...