CITED1 Antibody (5H6) - Azide and BSA Free

Novus Biologicals | Catalog # H00004435-M03

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Flow Cytometry, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, Western Blot, Flow Cytometry, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 5H6

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for CITED1 Antibody (5H6) - Azide and BSA Free

Western Blot: CITED1 Antibody (5H6) [H00004435-M03]

Western Blot: CITED1 Antibody (5H6) [H00004435-M03]

Western Blot: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody (M03), clone 5H6. Lane 1: CITED1 transfected lysatE (19.9 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03]

Immunocytochemistry/ Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03]

Immunocytochemistry/Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03] - analysis of CITED1 expression in human embryonic kidney cells using anti-CITED1 antibody. Image from verified customer review.
Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03]

Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03]

CITED1-Antibody-5H6-Immunohistochemistry-H00004435-M03-img0010.jpg
Western Blot: CITED1 Antibody (5H6) [H00004435-M03]

Western Blot: CITED1 Antibody (5H6) [H00004435-M03]

Western Blot: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 expression in A-431 (Cat # L015V1).
Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03]

Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03]

Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of monoclonal antibody to CITED1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.2 ug/ml
Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03]

Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03]

Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 on paraffin embedded human fetal renal tissue. Image from verified customer review.
Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03]

Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03]

CITED1-Antibody-5H6-Immunohistochemistry-H00004435-M03-img0009.jpg
ELISA: CITED1 Antibody (5H6) [H00004435-M03]

ELISA: CITED1 Antibody (5H6) [H00004435-M03]

ELISA: CITED1 Antibody (5H6) [H00004435-M03] - Detection limit for recombinant GST tagged CITED1 is approximately 0.03ng/ml as a capture antibody.
CITED1 Antibody (5H6)

Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03] -

Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03] - The nephrogenic niche exhibited a complex spatial organization.(A) Pseudotime analysis of the nephrogenic niche (NPC) & the PTA. Two-dimensional DDRTree [18] embedding & the learned graph (shown as a black line) were calculated with Monocle 2 [17]. Labels & colors indicate cell types. (B) Schematic sketch of the CM indicating the distance d from the UB to the edge of the CM (solid arrow) & the relative distance s along the UB (dashed arrow), in which 0 & 1 represent the top & bottom of the CM, respectively. (C) Representative image of SIX2 & CITED1 immunostaining in a w15 human fetal kidney. Dashed lines in the insets indicate the outline of the nuclei, based on DAPI signal. Arrows in the inset point to cells in which CITED1 is concentrated in the nucleus. Scale bar = 50 μm. (D) Quantification of SIX2 & CITED1 immunostaining with respect to the distance d from UB or distance s along the UB; see panel A. Error bars indicate the SEM calculated over all evaluated profiles (n = 24). (E) Representative image of HSPA1A, NR4A1, & CKS2 immunostaining in a w15 human fetal kidney. Scale bar = 20 μm. (F) Representative image of UNCX & CITED1 immunostaining. Arrowheads indicate the presence of immunostaining signal. Scale bar = 100 μm. The numerical data underlying this figure can be found in S1 Data. CM, cap mesenchyme; NPC, nephron progenitor cell; PTA, pretubular aggregate; SEM, standard error of the mean; UB, ureteric bud; w15, week 15. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30789893), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
CITED1 Antibody (5H6)

Immunocytochemistry/ Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03] -

Immunocytochemistry/ Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03] - The nephrogenic niche exhibited a complex spatial organization.(A) Pseudotime analysis of the nephrogenic niche (NPC) & the PTA. Two-dimensional DDRTree [18] embedding & the learned graph (shown as a black line) were calculated with Monocle 2 [17]. Labels & colors indicate cell types. (B) Schematic sketch of the CM indicating the distance d from the UB to the edge of the CM (solid arrow) & the relative distance s along the UB (dashed arrow), in which 0 & 1 represent the top & bottom of the CM, respectively. (C) Representative image of SIX2 & CITED1 immunostaining in a w15 human fetal kidney. Dashed lines in the insets indicate the outline of the nuclei, based on DAPI signal. Arrows in the inset point to cells in which CITED1 is concentrated in the nucleus. Scale bar = 50 μm. (D) Quantification of SIX2 & CITED1 immunostaining with respect to the distance d from UB or distance s along the UB; see panel A. Error bars indicate the SEM calculated over all evaluated profiles (n = 24). (E) Representative image of HSPA1A, NR4A1, & CKS2 immunostaining in a w15 human fetal kidney. Scale bar = 20 μm. (F) Representative image of UNCX & CITED1 immunostaining. Arrowheads indicate the presence of immunostaining signal. Scale bar = 100 μm. The numerical data underlying this figure can be found in S1 Data. CM, cap mesenchyme; NPC, nephron progenitor cell; PTA, pretubular aggregate; SEM, standard error of the mean; UB, ureteric bud; w15, week 15. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30789893), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
CITED1 Antibody (5H6)

Immunocytochemistry/ Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03] -

Immunocytochemistry/ Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03] - The nephrogenic niche exhibited a complex spatial organization.(A) Pseudotime analysis of the nephrogenic niche (NPC) & the PTA. Two-dimensional DDRTree [18] embedding & the learned graph (shown as a black line) were calculated with Monocle 2 [17]. Labels & colors indicate cell types. (B) Schematic sketch of the CM indicating the distance d from the UB to the edge of the CM (solid arrow) & the relative distance s along the UB (dashed arrow), in which 0 & 1 represent the top & bottom of the CM, respectively. (C) Representative image of SIX2 & CITED1 immunostaining in a w15 human fetal kidney. Dashed lines in the insets indicate the outline of the nuclei, based on DAPI signal. Arrows in the inset point to cells in which CITED1 is concentrated in the nucleus. Scale bar = 50 μm. (D) Quantification of SIX2 & CITED1 immunostaining with respect to the distance d from UB or distance s along the UB; see panel A. Error bars indicate the SEM calculated over all evaluated profiles (n = 24). (E) Representative image of HSPA1A, NR4A1, & CKS2 immunostaining in a w15 human fetal kidney. Scale bar = 20 μm. (F) Representative image of UNCX & CITED1 immunostaining. Arrowheads indicate the presence of immunostaining signal. Scale bar = 100 μm. The numerical data underlying this figure can be found in S1 Data. CM, cap mesenchyme; NPC, nephron progenitor cell; PTA, pretubular aggregate; SEM, standard error of the mean; UB, ureteric bud; w15, week 15. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30789893), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for CITED1 Antibody (5H6) - Azide and BSA Free

Application
Recommended Usage

Flow Cytometry

1:10-1:1000

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1:500
Application Notes
FACS usage reported in scientific literature (PMID: 24349133).

Reviewed Applications

Read 2 reviews rated 4 using H00004435-M03 in the following applications:

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CITED1

CITED1 is highly expressed in most of the papillary thyroid carcinoma. It is not expressed in normal tissues except normal breast epithelium. Study shows that this protein functions as a selective coactivator for estrogen dependent transcription.

Alternate Names

cbp/p300-interacting transactivator 1, Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain1,MSG1Melanocyte-specific protein 1, melanocyte-specific gene 1

Entrez Gene IDs

4435 (Human)

Gene Symbol

CITED1

OMIM

300149 (Human)

Additional CITED1 Products

Product Documents for CITED1 Antibody (5H6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CITED1 Antibody (5H6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CITED1 Antibody (5H6) - Azide and BSA Free

Customer Reviews for CITED1 Antibody (5H6) - Azide and BSA Free (2)

4 out of 5
2 Customer Ratings
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used CITED1 Antibody (5H6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 2 of 2 reviews Showing All
Filter By:
  • CITED1 Antibody (5H6)
    Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: fetal renal tissue
    Species: Human
    Verified Customer | Posted 10/31/2016
    CITED1 expression in human fetal renal tissue, localized within the cap mesenchyme
    Low pH antigen retrieval of paraffin embedded tissue
    CITED1 Antibody (5H6) - Azide and BSA Free H00004435-M03
  • Name: Stefano Da Sacco
    Application: Immunofluorescence
    Sample Tested: human fetal kidney cells
    Species: Human
    Verified Customer | Posted 10/23/2014
    cited1 expression in human embryonic kidney cells
    CITED1 Antibody (5H6) - Azide and BSA Free H00004435-M03

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...