CKS2 Antibody (2H5-2C4) - Azide and BSA Free

Novus Biologicals | Catalog # H00001164-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 2H5-2C4

Format

Azide and BSA Free
View all CKS2 Primary Antibodies »

Product Specifications

Immunogen

CKS2 (AAH06458, 1 a.a. ~ 79 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK

Specificity

CKS2 - CDC28 protein kinase regulatory subunit 2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for CKS2 Antibody (2H5-2C4) - Azide and BSA Free

Western Blot: CKS2 Antibody (2H5-2C4) [H00001164-M01]

Western Blot: CKS2 Antibody (2H5-2C4) [H00001164-M01]

Western Blot: CKS2 Antibody (2H5-2C4) [H00001164-M01] - Analysis of CKS2 expression in transfected 293T cell line by CKS2 monoclonal antibody (M01), clone 2H5-2C4.Lane 1: CKS2 transfected lysate(9.9 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: CKS2 Antibody (2H5-2C4) [H00001164-M01]

Immunocytochemistry/ Immunofluorescence: CKS2 Antibody (2H5-2C4) [H00001164-M01]

Immunocytochemistry/Immunofluorescence: CKS2 Antibody (2H5-2C4) [H00001164-M01] - Analysis of monoclonal antibody to CKS2 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: CKS2 Antibody (2H5-2C4) [H00001164-M01]

ELISA: CKS2 Antibody (2H5-2C4) [H00001164-M01]

ELISA: CKS2 Antibody (2H5-2C4) [H00001164-M01] - Detection limit for recombinant GST tagged CKS2 is approximately 3ng/ml as a capture antibody.
Sandwich ELISA: CKS2 Antibody (2H5-2C4) [H00001164-M01] - Detection limit for recombinant GST tagged CKS2 is approximately 3ng/ml as a capture antibody.

Applications for CKS2 Antibody (2H5-2C4) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IF and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CKS2

CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein.

Alternate Names

CDC28 protein kinase 2, CDC28 protein kinase regulatory subunit 2, CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2, CKS-2, CKSHS2, cyclin-dependent kinases regulatory subunit 2

Entrez Gene IDs

1164 (Human)

Gene Symbol

CKS2

OMIM

116901 (Human)

UniProt

AAH06458 (Human)

Additional CKS2 Products

Product Documents for CKS2 Antibody (2H5-2C4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CKS2 Antibody (2H5-2C4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CKS2 Antibody (2H5-2C4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CKS2 Antibody (2H5-2C4) - Azide and BSA Free and earn rewards!

Have you used CKS2 Antibody (2H5-2C4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies