Clathrin light chain Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38638

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Clathrin light chain Antibody - BSA Free

Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638]

Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638]

Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638] - Analysis in human fallopian tube and pancreas tissues. Corresponding CLTA RNA-seq data are presented for the same tissues.
Western Blot: Clathrin light chain Antibody [NBP2-38638]

Western Blot: Clathrin light chain Antibody [NBP2-38638]

Western Blot: Clathrin light chain Antibody [NBP2-38638] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638]

Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638]

Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638] - Staining of human pancreas shows weak to moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638]

Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638]

Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638]

Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638]

Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638] - Staining of human placenta shows moderate to strong cytoplasmic positivity in Hofbauer cells.
Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638]

Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638]

Immunohistochemistry-Paraffin: Clathrin light chain Antibody [NBP2-38638] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

Applications for Clathrin light chain Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Clathrin light chain

Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. Transcript Variant: This variant (1) lacks alternate in-frame exons, compared to variant 2, resulting in a shorter protein (isoform a), compared to isoform b. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

clathrin light chain A, clathrin, light chain A, Lca, light polypeptide (Lca)

Gene Symbol

CLTA

UniProt

Additional Clathrin light chain Products

Product Documents for Clathrin light chain Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Clathrin light chain Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Clathrin light chain Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Clathrin light chain Antibody - BSA Free and earn rewards!

Have you used Clathrin light chain Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...