CLK3 Antibody (1F10) - Azide and BSA Free
Novus Biologicals | Catalog # H00001198-M05
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2b Kappa Clone # 1F10
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
CLK3 (AAH02555, 36 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV
Specificity
CLK3 - CDC-like kinase 3
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2b Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for CLK3 Antibody (1F10) - Azide and BSA Free
Western Blot: CLK3 Antibody (1F10) [H00001198-M05]
Western Blot: CLK3 Antibody (1F10) [H00001198-M05] - Analysis of CLK3 expression in transfected 293T cell line by CLK3 monoclonal antibody (M05), clone 1F10. Lane 1: CLK3 transfected lysatE (58.6 KDa). Lane 2: Non-transfected lysate.Immunocytochemistry/ Immunofluorescence: CLK3 Antibody (1F10) [H00001198-M05]
Immunocytochemistry/Immunofluorescence: CLK3 Antibody (1F10) [H00001198-M05] - Analysis of monoclonal antibody to CLK3 on HeLa cell. Antibody concentration 8 ug/mL.Immunohistochemistry-Paraffin: CLK3 Antibody (1F10) [H00001198-M05]
Immunohistochemistry-Paraffin: CLK3 Antibody (1F10) [H00001198-M05] - Analysis of monoclonal antibody to CLK3 on FFPE human placenta. Antibody concentration 0.5 ug/mL.Western Blot: CLK3 Antibody (1F10) [H00001198-M05]
Western Blot: CLK3 Antibody (1F10) [H00001198-M05] - Analysis of CLK3 over-expressed 293 cell line, cotransfected with CLK3 Validated Chimera RNAi or non-transfected control. Blot probed with H00001198-M05. GAPDH (36.1 kDa) used as loading control.Western Blot: CLK3 Antibody (1F10) [H00001198-M05]
Western Blot: CLK3 Antibody (1F10) [H00001198-M05] - Analysis of CLK3 expression in HeLa S3 NE (Cat # L013V3).Western Blot: CLK3 Antibody (1F10) [H00001198-M05]
Western Blot: CLK3 Antibody (1F10) [H00001198-M05] - HeLa cell lysate. Antibody at 1:2000 in 5% BSA-TBST. Detection by Clarity Western ECL (BioRad). Image from verfied customer review.Applications for CLK3 Antibody (1F10) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactivity against recombinant protein and cell lysate for WB. It has been used for IF, RNAi Validation, IHC-P and ELISA.
Reviewed Applications
Read 1 review rated 4 using H00001198-M05 in the following applications:
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: CLK3
Long Name
Dual specificity protein kinase CLK3
Alternate Names
CDC-like kinase 3
Entrez Gene IDs
1198 (Human)
Gene Symbol
CLK3
OMIM
602990 (Human)
UniProt
Additional CLK3 Products
Product Documents for CLK3 Antibody (1F10) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CLK3 Antibody (1F10) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CLK3 Antibody (1F10) - Azide and BSA Free (1)
4 out of 5
1 Customer Rating
Have you used CLK3 Antibody (1F10) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Hela Cell LysateSpecies: HumanVerified Customer | Posted 01/03/2019Diluted CLK3 antibody (H00001198-M05) at 1:2000 in 5% BSA-TBST and probed the blot overnight at 4 degrees in shaker, followed by three 5 min washes in 1XTBST and probed with anti-Ms secondary at 1:5000, followed by three 5 min washes in 1XTBST and developed using Clarity Western ECL substrate from Bio-Rad. Shown is blot exposed for 7 s.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...