CLPP Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89557
![Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557]](https://resources.rndsystems.com/images/products/CLPP-Antibody-Immunohistochemistry-Paraffin-NBP1-89557-img0015.jpg "Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557]")
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Cited:
Immunohistochemistry-Frozen, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPA
Reactivity Notes
Reactivity reported in scientific literature (PMID: 22361696)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CLPP Antibody - BSA Free
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557]
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.![Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557]](https://resources.rndsystems.com/images/products/CLPP-Antibody-Immunohistochemistry-Paraffin-NBP1-89557-img0012.jpg "Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557]")
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557]
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.![Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557]](https://resources.rndsystems.com/images/products/CLPP-Antibody-Immunohistochemistry-Paraffin-NBP1-89557-img0013.jpg "Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557]")
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557]
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.![Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557]](https://resources.rndsystems.com/images/products/CLPP-Antibody-Immunohistochemistry-Paraffin-NBP1-89557-img0014.jpg "Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557]")
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557]
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.![CLPP Antibody - BSA Free Western Blot: CLPP Antibody - BSA Free [NBP1-89557]](https://resources.rndsystems.com/images/products/nbp1-89557_rabbit-polyclonal-clpp-antibody-1552025830332.jpg "Western Blot: CLPP Antibody - BSA Free [NBP1-89557]")
![CLPP Antibody - BSA Free Western Blot: CLPP Antibody - BSA Free [NBP1-89557]](https://resources.rndsystems.com/images/products/nbp1-89557_rabbit-polyclonal-clpp-antibody-1552025824424.jpg "Western Blot: CLPP Antibody - BSA Free [NBP1-89557]")
Western Blot: CLPP Antibody - BSA Free [NBP1-89557]
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Applications for CLPP Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200-1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in IHC-Frozen was reported in scientific literature (PMID: 30877431).
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CLPP
Alternate Names
ATP-dependent protease ClpAP, proteolytic subunit, human, ClpP (caseinolytic protease, ATP-dependent, proteolytic subunit, E. coli)homolog, ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E.coli), ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog, ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog (E.coli), EC 3.4.21.92, Endopeptidase Clp, putative ATP-dependent Clp protease proteolytic subunit, mitochondrial
Gene Symbol
CLPP
Additional CLPP Products
Product Documents for CLPP Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CLPP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for CLPP Antibody - BSA Free
Powered by Bioz
Customer Reviews for CLPP Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CLPP Antibody - BSA Free and earn rewards!
Have you used CLPP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...