CLPTM1L Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-84378
![Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]](https://resources.rndsystems.com/images/products/CLPTM1L-Antibody-Immunohistochemistry-Paraffin-NBP1-84378-img0006.jpg "Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Predicted:
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYL
Reactivity Notes
Human reactivity reported in scientific literature (PMID: 24648346).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CLPTM1L Antibody - BSA Free
![Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]](https://resources.rndsystems.com/images/products/CLPTM1L-Antibody-Immunohistochemistry-Paraffin-NBP1-84378-img0011.jpg "Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]")
Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]
Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human tonsil shows strong cytoplasmic postivity in non-germinal center cells.![Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]](https://resources.rndsystems.com/images/products/CLPTM1L-Antibody-Immunohistochemistry-Paraffin-NBP1-84378-img0007.jpg "Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]")
Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]
Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human duodenum shows strong cytoplasmic positivity in lymphoid cells.![Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]](https://resources.rndsystems.com/images/products/CLPTM1L-Antibody-Immunohistochemistry-Paraffin-NBP1-84378-img0008.jpg "Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]")
Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]
Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human lung cancer, adenocarcinoma shows strong positivity.![Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]](https://resources.rndsystems.com/images/products/CLPTM1L-Antibody-Immunohistochemistry-Paraffin-NBP1-84378-img0009.jpg "Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]")
Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]
Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.![Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]](https://resources.rndsystems.com/images/products/CLPTM1L-Antibody-Immunohistochemistry-Paraffin-NBP1-84378-img0010.jpg "Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]")
Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378]
Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human skeletal muscle shows no postivity in myocytes as expected.
Immunohistochemistry: CLPTM1L Antibody [NBP1-84378] -
Immunohistochemistry: CLPTM1L Antibody [NBP1-84378] - Representative Immunohistochemical staining according to Cleft Lip & Palate Transmembrane 1-Like (Clptm1L) & TMEM207 immunoreactivity at the invasion front of oral squamous cell carcinoma (OSCC). Weak Clptm1L or TMEM207 immunoreactivity was found in non-tumorous oral epithelial cells (A,B), respectively. In contrast, Clptm1L or TMEM207 immunoreactivity was found in many invasive OSCC cells. Representative positive Clptm1L immunoreactivity in tissue specimens from patients with favorable & poor prognosis is shown in (C,D), respectively. TMEM207 immunoreactivity in tissue specimens from patients with favorable & poor prognosis is shown in (E,F), respectively. Note the robust Clptm1L & TMEM207 immunoreactivity in (D,F). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35047994), licensed under a CC-BY license. Not internally tested by Novus Biologicals.![CLPTM1L Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: CLPTM1L Antibody [NBP1-84378]](https://resources.rndsystems.com/images/products/nbp1-84378_-immunocytochemistry-immunofluorescence-639174076517796028.jpg "Immunocytochemistry/ Immunofluorescence: CLPTM1L Antibody [NBP1-84378]")
Immunocytochemistry/ Immunofluorescence: CLPTM1L Antibody [NBP1-84378]
Staining of human cell line U-251 MG shows localization to endoplasmic reticulum.Applications for CLPTM1L Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500-1:1000
Application Notes
IHC, ICC/IF reported in scientific literature (PMID: 24648346). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CLPTM1L
Alternate Names
cisplatin resistance related protein CRR9p, Cisplatin resistance-related protein 9, cleft lip and palate transmembrane protein 1-like protein, CLPTM1-like, CLPTM1-like protein, CRR9DKFZp761M2324, CRR9p, DKFZp666M1010, FLJ14400, FLJ32533
Gene Symbol
CLPTM1L
Additional CLPTM1L Products
Product Documents for CLPTM1L Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CLPTM1L Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for CLPTM1L Antibody - BSA Free
Powered by Bioz
Customer Reviews for CLPTM1L Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CLPTM1L Antibody - BSA Free and earn rewards!
Have you used CLPTM1L Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...