Coatomer Subunit Delta Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35490

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 212-511 of human Coatomer Subunit Delta (NP_001646.2).

Sequence:
VAPAPARPSGPSKALKLGAKGKEVDNFVDKLKSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTETTFLVDKYEIL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Coatomer Subunit Delta Antibody - BSA Free

Coatomer Subunit Delta Antibody

Western Blot: Coatomer Subunit Delta Antibody [NBP3-35490] -

Western Blot: Coatomer Subunit Delta Antibody [NBP3-35490] - Western blot analysis of various lysates using Coatomer Subunit Delta Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Coatomer Subunit Delta Antibody

Immunocytochemistry/ Immunofluorescence: Coatomer Subunit Delta Antibody [NBP3-35490] -

Immunocytochemistry/ Immunofluorescence: Coatomer Subunit Delta Antibody [NBP3-35490] - Immunofluorescence analysis of HeLa cells using Coatomer Subunit Delta Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Coatomer Subunit Delta Antibody

Immunocytochemistry/ Immunofluorescence: Coatomer Subunit Delta Antibody [NBP3-35490] -

Immunocytochemistry/ Immunofluorescence: Coatomer Subunit Delta Antibody [NBP3-35490] - Immunofluorescence analysis of C6 cells using Coatomer Subunit Delta Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Coatomer Subunit Delta Antibody

Immunocytochemistry/ Immunofluorescence: Coatomer Subunit Delta Antibody [NBP3-35490] -

Immunocytochemistry/ Immunofluorescence: Coatomer Subunit Delta Antibody [NBP3-35490] - Immunofluorescence analysis of NIH/3T3 cells using Coatomer Subunit Delta Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Coatomer Subunit Delta Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Coatomer Subunit Delta

Coatomer Subunit Delta maps in a region, which include the mixed lineage leukemia and Friend leukemia virus integration 1 genes, where multiple disease-associated chromosome translocations occur. It is an intracellular protein. Archain sequences are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking. [provided by RefSeq]

Alternate Names

Archain, archain 1, archain vesicle transport protein 1, coatomer delta subunit, coatomer protein complex, subunit delta, coatomer protein delta-COP, coatomer subunit delta, COPD, Delta-coat protein, Delta-COP

Gene Symbol

ARCN1

Additional Coatomer Subunit Delta Products

Product Documents for Coatomer Subunit Delta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Coatomer Subunit Delta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Coatomer Subunit Delta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Coatomer Subunit Delta Antibody - BSA Free and earn rewards!

Have you used Coatomer Subunit Delta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...