COX-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85500

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Predicted:

Rat (90%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all COX-1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGN

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for COX-1 Antibody - BSA Free

Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500]

Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500]

Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining in human skin and skeletal muscle tissues using anti-PTGS1 antibody. Corresponding PTGS1 RNA-seq data are presented for the same tissues.
Western Blot: COX-1 Antibody [NBP1-85500]

Western Blot: COX-1 Antibody [NBP1-85500]

Western Blot: COX-1 Antibody [NBP1-85500] - Analysis in human cell line HELA.
Immunocytochemistry/ Immunofluorescence: COX-1 Antibody [NBP1-85500]

Immunocytochemistry/ Immunofluorescence: COX-1 Antibody [NBP1-85500]

COX-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85500-img0014.jpg
Immunocytochemistry/ Immunofluorescence: COX-1 Antibody [NBP1-85500]

Immunocytochemistry/ Immunofluorescence: COX-1 Antibody [NBP1-85500]

Immunocytochemistry/Immunofluorescence: COX-1 Antibody [NBP1-85500] - Staining of human cell line BJ shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500]

Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500]

Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500]

Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500]

Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining of human skin shows high expression.
Simple Western: COX-1 Antibody [NBP1-85500]

Simple Western: COX-1 Antibody [NBP1-85500]

Simple Western: COX-1 Antibody [NBP1-85500] - Lane view shows one specific signal (~70kDa) in lysates prepared from the mouse tail vein. Image from a verified customer review.
COX-1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: COX-1 Antibody - BSA Free [NBP1-85500] -

Validation of gene expression changes from RNA-Seq experiments. a, c Expression of Cpt2 and Krt5 in the urothelium of Ppargfl/fl controls (a) and ShhCre;Ppargfl/fl mutants (c). b, d Cox1 and Krt5 expression in a control (b) and in the ShhCre;Ppargfl/fl mutant urothelium (d). e, g Sod1 and Krt5 expression in a Ppargfl/fl control urothelium (e) and in the urothelium of an ShhCre;Ppargfl/fl mutant (g). f, h Sod2 and Krt5 expression in the urothelium of a Ppargfl/fl control (f) and in a ShhCre;Ppargfl/fl mutant urothelium (h). i, l Uchl1 and Krt5 expression in the urothelium of a wild-type adult tongue (i) and in the urothelium of a ShhCre;Ppargfl/fl mutant (l). j, m Expression of Sprr1a and Krt5 in the urothelium of a control (j) and in a urothelium of a ShhCre;Ppargfl/fl mutant (m). k, n Cldn8 and Krt5 expression in a control urothelium (k) and in a ShhCre;Ppargfl/fl mutant (n). o, q)Krt6 and Krt5 expression in a control urothelium (o) and in a ShhCre;Ppargfl/fl mutant (q). p, r Uchl1 and Krt5 expression in a control urothelium (p) and in a ShhCre;Ppargfl/fl mutant (r) urothelium. Scale bars: 50 μm. Adult wild type, n = 6; adult mutant, n = 5 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/31597917), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
COX-1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: COX-1 Antibody - BSA Free [NBP1-85500] -

Validation of gene expression changes from RNA-Seq experiments. a, c Expression of Cpt2 and Krt5 in the urothelium of Ppargfl/fl controls (a) and ShhCre;Ppargfl/fl mutants (c). b, d Cox1 and Krt5 expression in a control (b) and in the ShhCre;Ppargfl/fl mutant urothelium (d). e, g Sod1 and Krt5 expression in a Ppargfl/fl control urothelium (e) and in the urothelium of an ShhCre;Ppargfl/fl mutant (g). f, h Sod2 and Krt5 expression in the urothelium of a Ppargfl/fl control (f) and in a ShhCre;Ppargfl/fl mutant urothelium (h). i, l Uchl1 and Krt5 expression in the urothelium of a wild-type adult tongue (i) and in the urothelium of a ShhCre;Ppargfl/fl mutant (l). j, m Expression of Sprr1a and Krt5 in the urothelium of a control (j) and in a urothelium of a ShhCre;Ppargfl/fl mutant (m). k, n Cldn8 and Krt5 expression in a control urothelium (k) and in a ShhCre;Ppargfl/fl mutant (n). o, q)Krt6 and Krt5 expression in a control urothelium (o) and in a ShhCre;Ppargfl/fl mutant (q). p, r Uchl1 and Krt5 expression in a control urothelium (p) and in a ShhCre;Ppargfl/fl mutant (r) urothelium. Scale bars: 50 μm. Adult wild type, n = 6; adult mutant, n = 5 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/31597917), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for COX-1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50-1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes

IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization, Use PFA/Triton X-100. COX-1 antibody validated for Simple Western from a verified customer review.
See Simple Western Antibody Database for Simple Western validation: Tested in Mouse tail vein lysates, separated by Size, apparent MW was 70 kDa

Reviewed Applications

Read 1 review rated 5 using NBP1-85500 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COX-1

Cyclooxygenase (COX), also known as prostaglandin G/H synthase, is a membrane bound enzyme partly responsible for the catalysis of prostanoid synthesis. COX is expressed as at least three different isoforms. COX-1 is constitutively expressed and thought to regulate a number of 'housekeeping' functions such as vascular hemostasis, renal blood flow, and glomerular function. COX-2 expression is tightly regulated and induced by inflammatory mediators such as growth factors, cytokines, and endotoxin. COX-3 appears to be much more strictly regulated spatially and is observed in greatest abundance in cerebral cortex.

Long Name

Cyclooxygenase 1

Alternate Names

COX1, PTGS1

Gene Symbol

PTGS1

Additional COX-1 Products

Product Documents for COX-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for COX-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for COX-1 Antibody - BSA Free

Customer Reviews for COX-1 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used COX-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • COX-1 Antibody
    Name: Anonymous
    Application: Simple Western
    Sample Tested: tail vein lysates
    Species: Mouse
    Verified Customer | Posted 11/02/2017
    Simple Western lane view shows one specific signal (~70kDa) in lysates prepared from the mouse tail vein.
    This run was performed under reducing conditions using the 12-230 kDa separation system in combination with a rabbit detection system. Lysis buffer: RIPA, prot. conc.: 0.7 µg/µl.
    COX-1 Antibody - BSA Free NBP1-85500

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for COX-1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Please could you tell me if Novus Biologicals has an active COX1 Recombinant Protein?

    A: Unfortunately we do not currently have any COX1 recombinant proteins that are expected to be active.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies