CRABP1 Antibody (7N4F3)

Novus Biologicals | Catalog # NBP3-16601

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7N4F3 expressed in HEK293
View all CRABP1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 58-137 of human CRABP1 (P29762). TVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CRABP1 Antibody (7N4F3)

Western Blot: CRABP1 Antibody (7N4F3) [NBP3-16601]

Western Blot: CRABP1 Antibody (7N4F3) [NBP3-16601]

Western Blot: CRABP1 Antibody (7N4F3) [NBP3-16601] - Analysis of extracts of various cell lines, using CRABP1 Rabbit mAb (NBP3-16601) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry: CRABP1 Antibody (7N4F3) [NBP3-16601]

Immunohistochemistry: CRABP1 Antibody (7N4F3) [NBP3-16601]

Immunohistochemistry: CRABP1 Antibody (7N4F3) [NBP3-16601] - Immunofluorescence analysis of rat eye using CRABP1 Rabbit mAb (NBP3-16601) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: CRABP1 Antibody (7N4F3) [NBP3-16601]

Western Blot: CRABP1 Antibody (7N4F3) [NBP3-16601]

Western Blot: CRABP1 Antibody (7N4F3) [NBP3-16601] - Analysis of extracts of Mouse testis, using CRABP1 Rabbit mAb (NBP3-16601) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for CRABP1 Antibody (7N4F3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CRABP1

Retinoic acid (RA), a metabolite of vitamin A, plays an important role in growth and differentiation by modulation of expression of certain genes. RA functions through its interaction with the nuclear protein, retinoic acid receptor (RAR) and the 9-cis RA with retinoid X receptor (RXR). The Cellular Retinoic Acid Binding Proteins (CRABP) bind RA with a high affinity and belong to the family of fatty acid binding proteins. Two forms of CRABP have been characterized, CRABP 1 and CRABP 2 which share ~75% sequence conservation. The main role of CRABP 1 may be to protect retinoids from non-specific dehydrogenases and direct them to specific enzymes. The precise role of CRABP 2 is still poorly understood but it seems to play a role in the interaction of ligands (RA, 9-cis RA) with nuclear receptors (RAR/RXR).

Alternate Names

cellular retinoic acid binding protein 1, CRABP, CRABPI, CRABP-Icellular retinoic acid-binding protein 1, RBP5Cellular retinoic acid-binding protein I

Gene Symbol

CRABP1

Additional CRABP1 Products

Product Documents for CRABP1 Antibody (7N4F3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CRABP1 Antibody (7N4F3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CRABP1 Antibody (7N4F3)

Customer Reviews for CRABP1 Antibody (7N4F3)

There are currently no reviews for this product. Be the first to review CRABP1 Antibody (7N4F3) and earn rewards!

Have you used CRABP1 Antibody (7N4F3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies