CRAT Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86616

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (90%), Rat (90%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CRAT Antibody - BSA Free

CRAT Antibody - BSA Free Immunohistochemistry-Paraffin: CRAT Antibody - BSA Free [NBP1-86616]

Immunohistochemistry-Paraffin: CRAT Antibody - BSA Free [NBP1-86616]

Analysis in human testis and lymph node tissues Corresponding CRAT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616]

Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616]

Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616]

Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616]

Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining of human lymph node shows no positivity as expected.
Western Blot: CRAT Antibody [NBP1-86616]

Western Blot: CRAT Antibody [NBP1-86616]

Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
CRAT Antibody - BSA Free Western Blot: CRAT Antibody - BSA Free [NBP1-86616]

Western Blot: CRAT Antibody - BSA Free [NBP1-86616]

Analysis in human cell line TD47D.
CRAT Antibody - BSA Free

Western Blot: CRAT Antibody - BSA Free [NBP1-86616] -

Reduced FAO enzymes and morphological changes in mitochondria following the decline in OCTN2 occur in SDT-f-DKD rats.(A) Plasma free Car (nmol/L) and (B) ratio of short-chain Acyl-C/middle-to-long-chain Acyl-C over the time course of SDT-f-DKD. (C) Western blots for OCTN2, CPT1a, CPT2, CrAT, and beta -actin in the kidneys of SDT-f-DKD rats and (D) corresponding quantitation over the time course of SDT-f-DKD. n = 4, respectively. (E) Real-time PCR for Tmlhe in the kidneys of SDT-f-DKD rats at 7, 9, 12, and 17 weeks. n = 4, respectively. (F) Representative images of Oil Red O staining, immunofluorescence staining for KIM-1, and Picrosirius red staining over the time course of SDT-f-DKD and (G) the corresponding quantitation for Oil Red O+ area/cortex (%), KIM-1+/cortex (%), and collagen deposition area/cortex (%). Scale bar: 50 μm. n = 4, respectively. Data are presented as means +/- SD. One-way ANOVA with Tukey’s post hoc test (A, B, D, E, and G) were performed to determine P value. **P < 0.01, ***P < 0.001, and ****P < 0.0001. Tmlhe, trimethyllysine hydroxylase, epsilon; wks, weeks; LTL, lotus tetragonolobus lectin. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40402578), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
CRAT Antibody - BSA Free

Western Blot: CRAT Antibody - BSA Free [NBP1-86616] -

Salt-sensitive hypertension partially induces PTC carnitine deficiency with reduced plasma free Car.(A) Line graph shows systolic BP (mmHg) over time in Dahl-NS (n = 6), Dahl-HS (n = 7), and Dahl-HS+L-car (n = 6). (B) Plasma free Car (nmol/L) and (C) ratio of short-chain Acyl-C/middle-to-long-chain Acyl-C. (D) Western blots for CPT1a, CPT2, CrAT, and beta -actin in the kidneys of Dahl-NS and Dahl-HS and (E) corresponding quantitation. n = 4, respectively. (F) Representative images for OCTN2 and (G) the corresponding quantitation for OCTN2+/HPF (%) in Dahl-NS (n = 6), Dahl-HS (n = 7), and Dahl-HS+L-car (n = 6). Scale bar, 50 μm. (H) Real-time PCR for Tmlhe in the kidneys of Dahl-NS and Dahl-HS. n = 4, respectively. (I) Representative images of Oil Red O staining, immunofluorescence staining for KIM-1, and Picrosirius red staining in Dahl-NS, Dahl-HS, and Dahl-HS+L-car. Scale bar, 50 μm. (J) The corresponding quantitation for Oil Red O+ area/cortex (%), KIM-1+/cortex (%), and collagen+ area/cortex (%). n = 4, respectively. Data are presented as means +/- SD. Unpaired, 2-tailed Student’s t test (B, C, E, and H) and 1-way ANOVA with Tukey’s post hoc test (G and J) were performed to determine P value. *P < 0.05, ***P < 0.001, ****P < 0.0001. NS, normal salt. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40402578), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
CRAT Antibody - BSA Free

Western Blot: CRAT Antibody - BSA Free [NBP1-86616] -

FAO-related transporter and enzymes are reduced in SDT-f-DKD rats.(A) Western blots for OCTN2, CPT1a, CPT2, CrAT, and beta -actin in the kidneys of SD, SDT-f, and SDT-f-DKD rats. (B) Quantification of OCTN2/ beta -actin, (C) CPT1a/ beta -actin, (D) CPT2/ beta -actin, and (E) CrAT/ beta -actin in SD (n = 4), SDT-f (n = 4), and SDT-f-DKD rats (n = 4). (F) Western blots for p-AMPK, AMPK, PGC-1 alpha, and beta -actin in SD, SDT-f, and SDT-f-DKD rats. (G) Ratio of p-AMPK/AMPK and (H) quantification of PGC-1 alpha / beta -actin in SD (n = 4), SDT-f (n = 4), and SDT-f-DKD rats (n = 4). Data are presented as means +/- SD. One-way ANOVA with Tukey’s post hoc test (B–E, G, and H) were performed to determine P value. *P < 0.05, **P < 0.01, and ***P < 0.001. OCTN2, organic cation transporter 2; CPT1a, carnitine palmitoyltransferase 1a; CPT2, carnitine palmitoyltransferase 2; CrAT, carnitine acetyltransferase; p-AMPK, phosphorylated AMP-activated protein kinase; PGC-1 alpha, peroxisome proliferator–activated receptor-gamma coactivator-1 alpha. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40402578), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for CRAT Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CRAT

Carnitine acetyltransferase (CRAT) is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Different subcellular localizations of the CRAT mRNAs are thought to result from alternative splicing of the CRAT gene suggested by the divergent sequences in the 5' region of peroxisomal and mitochondrial CRAT cDNAs and the location of an intron where the sequences diverge. The alternatively splicing of this gene results in three distinct isoforms, one of which contains an N-terminial mitochondrial transit peptide, and has been shown to be located in mitochondria.

Alternate Names

Carnitine acetylase, Carnitine acetyltransferaseCrAT, carnitine O-acetyltransferase, CAT, CAT1EC 2.3.1.7, EC 2.3.1

Gene Symbol

CRAT

Additional CRAT Products

Product Documents for CRAT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CRAT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CRAT Antibody - BSA Free

Customer Reviews for CRAT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CRAT Antibody - BSA Free and earn rewards!

Have you used CRAT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...