CRAT Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86616
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human
Cited:
Human
Predicted:
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDF
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CRAT Antibody - BSA Free
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616]
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616]
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining of human lymph node shows no positivity as expected.Western Blot: CRAT Antibody - BSA Free [NBP1-86616]
Analysis in human cell line TD47D.Western Blot: CRAT Antibody - BSA Free [NBP1-86616] -
Reduced FAO enzymes and morphological changes in mitochondria following the decline in OCTN2 occur in SDT-f-DKD rats.(A) Plasma free Car (nmol/L) and (B) ratio of short-chain Acyl-C/middle-to-long-chain Acyl-C over the time course of SDT-f-DKD. (C) Western blots for OCTN2, CPT1a, CPT2, CrAT, and beta -actin in the kidneys of SDT-f-DKD rats and (D) corresponding quantitation over the time course of SDT-f-DKD. n = 4, respectively. (E) Real-time PCR for Tmlhe in the kidneys of SDT-f-DKD rats at 7, 9, 12, and 17 weeks. n = 4, respectively. (F) Representative images of Oil Red O staining, immunofluorescence staining for KIM-1, and Picrosirius red staining over the time course of SDT-f-DKD and (G) the corresponding quantitation for Oil Red O+ area/cortex (%), KIM-1+/cortex (%), and collagen deposition area/cortex (%). Scale bar: 50 μm. n = 4, respectively. Data are presented as means +/- SD. One-way ANOVA with Tukey’s post hoc test (A, B, D, E, and G) were performed to determine P value. **P < 0.01, ***P < 0.001, and ****P < 0.0001. Tmlhe, trimethyllysine hydroxylase, epsilon; wks, weeks; LTL, lotus tetragonolobus lectin. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40402578), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: CRAT Antibody - BSA Free [NBP1-86616] -
Salt-sensitive hypertension partially induces PTC carnitine deficiency with reduced plasma free Car.(A) Line graph shows systolic BP (mmHg) over time in Dahl-NS (n = 6), Dahl-HS (n = 7), and Dahl-HS+L-car (n = 6). (B) Plasma free Car (nmol/L) and (C) ratio of short-chain Acyl-C/middle-to-long-chain Acyl-C. (D) Western blots for CPT1a, CPT2, CrAT, and beta -actin in the kidneys of Dahl-NS and Dahl-HS and (E) corresponding quantitation. n = 4, respectively. (F) Representative images for OCTN2 and (G) the corresponding quantitation for OCTN2+/HPF (%) in Dahl-NS (n = 6), Dahl-HS (n = 7), and Dahl-HS+L-car (n = 6). Scale bar, 50 μm. (H) Real-time PCR for Tmlhe in the kidneys of Dahl-NS and Dahl-HS. n = 4, respectively. (I) Representative images of Oil Red O staining, immunofluorescence staining for KIM-1, and Picrosirius red staining in Dahl-NS, Dahl-HS, and Dahl-HS+L-car. Scale bar, 50 μm. (J) The corresponding quantitation for Oil Red O+ area/cortex (%), KIM-1+/cortex (%), and collagen+ area/cortex (%). n = 4, respectively. Data are presented as means +/- SD. Unpaired, 2-tailed Student’s t test (B, C, E, and H) and 1-way ANOVA with Tukey’s post hoc test (G and J) were performed to determine P value. *P < 0.05, ***P < 0.001, ****P < 0.0001. NS, normal salt. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40402578), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: CRAT Antibody - BSA Free [NBP1-86616] -
FAO-related transporter and enzymes are reduced in SDT-f-DKD rats.(A) Western blots for OCTN2, CPT1a, CPT2, CrAT, and beta -actin in the kidneys of SD, SDT-f, and SDT-f-DKD rats. (B) Quantification of OCTN2/ beta -actin, (C) CPT1a/ beta -actin, (D) CPT2/ beta -actin, and (E) CrAT/ beta -actin in SD (n = 4), SDT-f (n = 4), and SDT-f-DKD rats (n = 4). (F) Western blots for p-AMPK, AMPK, PGC-1 alpha, and beta -actin in SD, SDT-f, and SDT-f-DKD rats. (G) Ratio of p-AMPK/AMPK and (H) quantification of PGC-1 alpha / beta -actin in SD (n = 4), SDT-f (n = 4), and SDT-f-DKD rats (n = 4). Data are presented as means +/- SD. One-way ANOVA with Tukey’s post hoc test (B–E, G, and H) were performed to determine P value. *P < 0.05, **P < 0.01, and ***P < 0.001. OCTN2, organic cation transporter 2; CPT1a, carnitine palmitoyltransferase 1a; CPT2, carnitine palmitoyltransferase 2; CrAT, carnitine acetyltransferase; p-AMPK, phosphorylated AMP-activated protein kinase; PGC-1 alpha, peroxisome proliferator–activated receptor-gamma coactivator-1 alpha. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40402578), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for CRAT Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CRAT
Alternate Names
Carnitine acetylase, Carnitine acetyltransferaseCrAT, carnitine O-acetyltransferase, CAT, CAT1EC 2.3.1.7, EC 2.3.1
Gene Symbol
CRAT
Additional CRAT Products
Product Documents for CRAT Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CRAT Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for CRAT Antibody - BSA Free
Customer Reviews for CRAT Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CRAT Antibody - BSA Free and earn rewards!
Have you used CRAT Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...