CXADR Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88192

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CXADR Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%). Mouse reactivity reported in the scientific literature (PMID: 26076477).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CXADR Antibody - BSA Free

Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192]

Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192]

Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Analysis in human skin and skeletal muscle tissues using NBP1-88192 antibody. Corresponding CXADR RNA-seq data are presented for the same tissues.
Western Blot: CXADR Antibody [NBP1-88192]

Western Blot: CXADR Antibody [NBP1-88192]

Western Blot: CXADR Antibody [NBP1-88192] - Analysis in human cell lines Caco-2 and MCF-7. Corresponding CXADR RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: CXADR Antibody [NBP1-88192]

Immunocytochemistry/ Immunofluorescence: CXADR Antibody [NBP1-88192]

Immunocytochemistry/Immunofluorescence: CXADR Antibody [NBP1-88192] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192]

Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192]

Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192]

Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192]

Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192]

Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192]

Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192]

Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192]

Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.

Applications for CXADR Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CXADR

Coxsackie Adenovirus Receptor is encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Pseudogenes of this gene are found on chromosomes 15, 18, and 21. [provided by RefSeq]

Long Name

Coxsackie and Adenovirus Receptor

Alternate Names

CVB3 BP

Gene Symbol

CXADR

Additional CXADR Products

Product Documents for CXADR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CXADR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Infectious Diseases

Citations for CXADR Antibody - BSA Free

Customer Reviews for CXADR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CXADR Antibody - BSA Free and earn rewards!

Have you used CXADR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies