CYP21A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13893

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: GLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSRNYPDLSLGDYSLLW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CYP21A2 Antibody - BSA Free

Western Blot: CYP21A2 Antibody [NBP2-13893]

Western Blot: CYP21A2 Antibody [NBP2-13893]

Western Blot: CYP21A2 Antibody [NBP2-13893] - Analysis in human adrenal gland tissue.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human testis.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human kidney.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human adrenal gland using Anti-CYP21A2 antibody NBP2-13893.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human adrenal gland, kidney, pancreas and testis using Anti-CYP21A2 antibody NBP2-13893 (A) shows similar protein distribution across tissues to independent antibody NBP2-38698 (B).
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Analysis in human adrenal gland and kidney tissues using NBP2-13893 antibody. Corresponding CYP21A2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells in adrenal cortex.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893]

Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human kidney shows no positivity in cells in tubules as expected.

Applications for CYP21A2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CYP21A2

The CYP21A2 gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins aremonooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids andother lipids. This protein localiz

Long Name

Cytochrome P450 Family 21 Subfamily A Member 2

Alternate Names

21-OHase, CAH1, CPS1, CYP21, CYP21B

Gene Symbol

CYP21A2

Additional CYP21A2 Products

Product Documents for CYP21A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CYP21A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CYP21A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CYP21A2 Antibody - BSA Free and earn rewards!

Have you used CYP21A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...