CYP4V2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38288

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CYP4V2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CYP4V2 (NP_997235.3).

Sequence:
LMFKEGWEHKKSLQILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CYP4V2 Antibody - BSA Free

CYP4V2 Antibody

Immunocytochemistry/ Immunofluorescence: CYP4V2 Antibody [NBP3-38288] -

Immunocytochemistry/ Immunofluorescence: CYP4V2 Antibody [NBP3-38288] - Immunofluorescence analysis of NIH/3T3 cells using CYP4V2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CYP4V2 Antibody

Western Blot: CYP4V2 Antibody [NBP3-38288] -

Western Blot: CYP4V2 Antibody [NBP3-38288] - Western blot analysis of various lysates, using CYP4V2 Rabbit pAb at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
CYP4V2 Antibody

Immunocytochemistry/ Immunofluorescence: CYP4V2 Antibody [NBP3-38288] -

Immunocytochemistry/ Immunofluorescence: CYP4V2 Antibody [NBP3-38288] - Immunofluorescence analysis of U-87MG cells using CYP4V2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for CYP4V2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CYP4V2

Alternate Names

BCD, CYP4AH1, cytochrome P450 4V2, cytochrome P450, family 4, subfamily V, polypeptide 2, EC 1.14, EC 1.14.14.1, FLJ18432, MGC43534

Gene Symbol

CYP4V2

Additional CYP4V2 Products

Product Documents for CYP4V2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CYP4V2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CYP4V2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CYP4V2 Antibody - BSA Free and earn rewards!

Have you used CYP4V2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies