CYP7B1 Antibody (2B11) - Azide and BSA Free

Novus Biologicals | Catalog # H00009420-M06

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2B11

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

CYP7B1 (NP_004811, 203 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHH

Specificity

CYP7B1 - cytochrome P450, family 7, subfamily B, polypeptide 1 (2B11)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for CYP7B1 Antibody (2B11) - Azide and BSA Free

Western Blot: CYP7B1 Antibody (2B11) [H00009420-M06]

Western Blot: CYP7B1 Antibody (2B11) [H00009420-M06]

Western Blot: CYP7B1 Antibody (2B11) [H00009420-M06] - Analysis of CYP7B1 expression in transfected 293T cell line by CYP7B1 monoclonal antibody (M06), clone 2B11. Lane 1: CYP7B1 transfected lysatE (58.256 KDa). Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: CYP7B1 Antibody (2B11) [H00009420-M06]

Immunohistochemistry-Paraffin: CYP7B1 Antibody (2B11) [H00009420-M06]

Immunohistochemistry-Paraffin: CYP7B1 Antibody (2B11) [H00009420-M06] - Analysis of monoclonal antibody to CYP7B1 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml
ELISA: CYP7B1 Antibody (2B11) [H00009420-M06]

ELISA: CYP7B1 Antibody (2B11) [H00009420-M06]

ELISA: CYP7B1 Antibody (2B11) [H00009420-M06] - Detection limit for recombinant GST tagged CYP7B1 is approximately 0.3ng/ml as a capture antibody.

Applications for CYP7B1 Antibody (2B11) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CYP7B1

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis. [provided by RefSeq]

Alternate Names

CBAS3, CP7B, Cytochrome P450 7B1, cytochrome P450, family 7, subfamily B, polypeptide 1, cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1,25-hydroxycholesterol 7-alpha-hydroxylase, EC 1.14.13.100, Oxysterol 7-alpha-hydroxylase, oxysterol 7alpha-hydroxylase, spastic paraplegia 5A (autosomal recessive), SPG5A

Entrez Gene IDs

9420 (Human)

Gene Symbol

CYP7B1

Additional CYP7B1 Products

Product Documents for CYP7B1 Antibody (2B11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CYP7B1 Antibody (2B11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CYP7B1 Antibody (2B11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CYP7B1 Antibody (2B11) - Azide and BSA Free and earn rewards!

Have you used CYP7B1 Antibody (2B11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...