CYP7B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35797

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP7B1 (NP_004811.1).

Sequence:
VIVCDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHHLGFLWASVANTIPT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CYP7B1 Antibody - BSA Free

CYP7B1 Antibody

Western Blot: CYP7B1 Antibody [NBP3-35797] -

Western Blot: CYP7B1 Antibody [NBP3-35797] - Western blot analysis of lysates from A-431 cells, using CYP7B1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
CYP7B1 Antibody

Immunocytochemistry/ Immunofluorescence: CYP7B1 Antibody [NBP3-35797] -

Immunocytochemistry/ Immunofluorescence: CYP7B1 Antibody [NBP3-35797] - Immunofluorescence analysis of NIH/3T3 cells using CYP7B1 Rabbit pAb at dilution of 1:20 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CYP7B1 Antibody

Immunocytochemistry/ Immunofluorescence: CYP7B1 Antibody [NBP3-35797] -

Immunocytochemistry/ Immunofluorescence: CYP7B1 Antibody [NBP3-35797] - Immunofluorescence analysis of PC-12 cells using CYP7B1 Rabbit pAb at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

Applications for CYP7B1 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CYP7B1

P450 enzymes constitute a family of monooxygenase enzymes that are involved in the metabolism of a wide array of endogenous and xenobiotic compounds including cholesterol. CYP8B1 moderates the ratio of cholic acid over chenodeoxycholic acid to control the solubility of cholesterol. P450 cholesterol 7-hydroxylase, CYP7A1, is the rate limiting enzyme of bile acid synthesis in the liver, and its expression is mediated by the bile acid receptor FXR. CYP27A1 catalyzes vitamin D3 25-hydroxylation and is localized to the mitochondria in kidney and liver. CYP7B1 (oxysterol 7-alpha-hydroxylase) functions as an enzyme in the alternate bile acid synthesis pathway. Specifically, CYP7B1 metabolizes 25- and 27-hydroxycholesterol. The gene encoding human CYP7B1 maps to chromosome 8q21.3. Mutations in the CYP7B1 gene may cause a metabolic defect in bile acid synthesis characterized by elevated urinary bile acid excretion, severe cholestasis, cirrhosis and liver synthetic failure.

Alternate Names

CBAS3, CP7B, Cytochrome P450 7B1, cytochrome P450, family 7, subfamily B, polypeptide 1, cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1,25-hydroxycholesterol 7-alpha-hydroxylase, EC 1.14.13.100, Oxysterol 7-alpha-hydroxylase, oxysterol 7alpha-hydroxylase, spastic paraplegia 5A (autosomal recessive), SPG5A

Gene Symbol

CYP7B1

Additional CYP7B1 Products

Product Documents for CYP7B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CYP7B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CYP7B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CYP7B1 Antibody - BSA Free and earn rewards!

Have you used CYP7B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...