Cytochrome P450 2D6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91818

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytochrome P450 2D6 Antibody - BSA Free

Western Blot: Cytochrome P450 2D6 Antibody [NBP1-91818]

Western Blot: Cytochrome P450 2D6 Antibody [NBP1-91818]

Western Blot: Cytochrome P450 2D6 Antibody [NBP1-91818] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: Cytochrome P450 2D6 Antibody [NBP1-91818]

Immunohistochemistry-Paraffin: Cytochrome P450 2D6 Antibody [NBP1-91818]

Immunohistochemistry-Paraffin: Cytochrome P450 2D6 Antibody [NBP1-91818] - Staining in human small intestine and pancreas tissues using anti-CYP2D6 antibody. Corresponding CYP2D6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cytochrome P450 2D6 Antibody [NBP1-91818]

Immunohistochemistry-Paraffin: Cytochrome P450 2D6 Antibody [NBP1-91818]

Immunohistochemistry-Paraffin: Cytochrome P450 2D6 Antibody [NBP1-91818] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Cytochrome P450 2D6 Antibody [NBP1-91818]

Immunohistochemistry-Paraffin: Cytochrome P450 2D6 Antibody [NBP1-91818]

Immunohistochemistry-Paraffin: Cytochrome P450 2D6 Antibody [NBP1-91818] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Cytochrome P450 2D6 Antibody [NBP1-91818]

Immunohistochemistry-Paraffin: Cytochrome P450 2D6 Antibody [NBP1-91818]

Immunohistochemistry-Paraffin: Cytochrome P450 2D6 Antibody [NBP1-91818] - Staining of human small intestine shows high expression.
Cytochrome P450 2D6 Antibody - BSA Free Immunohistochemistry: Cytochrome P450 2D6 Antibody - BSA Free [NBP1-91818]

Immunohistochemistry: Cytochrome P450 2D6 Antibody - BSA Free [NBP1-91818]

Analysis in human liver and pancreas tissues using NBP1-91818 antibody. Corresponding CYP2D6 RNA-seq data are presented for the same tissues.
Cytochrome P450 2D6 Antibody - BSA Free Immunohistochemistry: Cytochrome P450 2D6 Antibody - BSA Free [NBP1-91818]

Immunohistochemistry: Cytochrome P450 2D6 Antibody - BSA Free [NBP1-91818]

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Cytochrome P450 2D6 Antibody - BSA Free Immunohistochemistry: Cytochrome P450 2D6 Antibody - BSA Free [NBP1-91818]

Immunohistochemistry: Cytochrome P450 2D6 Antibody - BSA Free [NBP1-91818]

Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Cytochrome P450 2D6 Antibody - BSA Free Immunohistochemistry: Cytochrome P450 2D6 Antibody - BSA Free [NBP1-91818]

Immunohistochemistry: Cytochrome P450 2D6 Antibody - BSA Free [NBP1-91818]

Staining of human kidney shows no positivity in cells in glomeruli as expected.
Cytochrome P450 2D6 Antibody - BSA Free Western Blot: Cytochrome P450 2D6 Antibody - BSA Free [NBP1-91818]

Western Blot: Cytochrome P450 2D6 Antibody - BSA Free [NBP1-91818]

Analysis in human liver tissue.
Cytochrome P450 2D6 Antibody - BSA Free Immunohistochemistry: Cytochrome P450 2D6 Antibody - BSA Free [NBP1-91818]

Immunohistochemistry: Cytochrome P450 2D6 Antibody - BSA Free [NBP1-91818]

Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Applications for Cytochrome P450 2D6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytochrome P450 2D6

Long Name

Cytochrome P450 2D6

Alternate Names

CYP2D6, CYP2DL1, CYPIID6, Cytochrome P450-DB1

Gene Symbol

CYP2D6

Additional Cytochrome P450 2D6 Products

Product Documents for Cytochrome P450 2D6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytochrome P450 2D6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytochrome P450 2D6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytochrome P450 2D6 Antibody - BSA Free and earn rewards!

Have you used Cytochrome P450 2D6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...