Cytokeratin 12 Antibody (2M1K10)
Novus Biologicals | Catalog # NBP3-33197
Loading...
Key Product Details
Species Reactivity
Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Monoclonal Rabbit IgG Clone # 2M1K10
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 250-494 of human Cytokeratin 12 (KRT12) (NP_000214.1).
Sequence:
EMQIESLNEELAYMKKNHEDELQSFRVGGPGEVSVEMDAAPGVDLTRLLNDMRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNGEVVSSQVQEIEELM
Sequence:
EMQIESLNEELAYMKKNHEDELQSFRVGGPGEVSVEMDAAPGVDLTRLLNDMRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNGEVVSSQVQEIEELM
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Cytokeratin 12 Antibody (2M1K10)
Immunohistochemistry: Cytokeratin 12 Antibody (2M1K10) [NBP3-33197] -
Immunohistochemistry: Cytokeratin 12 Antibody (2M1K10) [NBP3-33197] - Immunohistochemistry analysis of paraffin-embedded Rat cornea using Cytokeratin 12(KRT12) (KRT12) Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry: Cytokeratin 12 Antibody (2M1K10) [NBP3-33197] -
Immunohistochemistry: Cytokeratin 12 Antibody (2M1K10) [NBP3-33197] - Immunohistochemistry analysis of paraffin-embedded Mouse cornea using Cytokeratin 12(KRT12) (KRT12) Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Immunocytochemistry/ Immunofluorescence: Cytokeratin 12 Antibody (2M1K10) [NBP3-33197] -
Immunocytochemistry/ Immunofluorescence: Cytokeratin 12 Antibody (2M1K10) [NBP3-33197] - Confocal imaging of paraffin-embedded Rat eyeball tissue using Cytokeratin 12 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Immunocytochemistry/ Immunofluorescence: Cytokeratin 12 Antibody (2M1K10) [NBP3-33197] -
Immunocytochemistry/ Immunofluorescence: Cytokeratin 12 Antibody (2M1K10) [NBP3-33197] - Confocal imaging of paraffin-embedded Mouse eyeball tissue using Cytokeratin 12 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Applications for Cytokeratin 12 Antibody (2M1K10)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 ug/mL
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Cytokeratin 12
Alternate Names
CK12, K12, keratin 12, keratin, type I cytoskeletal 12
Gene Symbol
KRT12
Additional Cytokeratin 12 Products
Product Documents for Cytokeratin 12 Antibody (2M1K10)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Cytokeratin 12 Antibody (2M1K10)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Cytokeratin 12 Antibody (2M1K10)
There are currently no reviews for this product. Be the first to review Cytokeratin 12 Antibody (2M1K10) and earn rewards!
Have you used Cytokeratin 12 Antibody (2M1K10)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...