![Immunocytochemistry/ Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603]](https://resources.rndsystems.com/images/products/Cytokeratin-15-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85603-img0005.jpg "Immunocytochemistry/ Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Cytokeratin 15 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603]
Immunocytochemistry/Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603] - Staining of human cell line HaCaT shows localization to intermediate filaments. Antibody staining is shown in green.
Immunocytochemistry/Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603] -
Immunocytochemistry/Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603] - Overnight incubation at 4ºC with Keratin 15 antibody diluted 1:400 in PBS/BSA 1%. Green: Cytokeratin 15, Blue: DAPI. Image from verified customer review.![Cytokeratin 15 Antibody - BSA Free Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]](https://resources.rndsystems.com/images/products/nbp1-85603_rabbit-polyclonal-cytokeratin-15-antibody-23420251561928.jpg "Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]")
Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]
Staining of human liver shows no positivity in hepatocytes as expected.![Cytokeratin 15 Antibody - BSA Free Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]](https://resources.rndsystems.com/images/products/nbp1-85603_rabbit-polyclonal-cytokeratin-15-antibody-23420251573983.jpg "Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]")
Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]
Staining of human prostate shows strong membranous positivity in glandular cells.![Cytokeratin 15 Antibody - BSA Free Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]](https://resources.rndsystems.com/images/products/nbp1-85603_rabbit-polyclonal-cytokeratin-15-antibody-23420251592584.jpg "Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]")
Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]
Staining of human skin shows strong membranous/cytoplasmic positivity in squamous epithelial cells.![Cytokeratin 15 Antibody - BSA Free Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]](https://resources.rndsystems.com/images/products/nbp1-85603_rabbit-polyclonal-cytokeratin-15-antibody-23420251584492.jpg "Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]")
Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]
Staining of human skeletal muscle shows no positivity in myocytes as expected.![Cytokeratin 15 Antibody - BSA Free Western Blot: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]](https://resources.rndsystems.com/images/products/nbp1-85603_rabbit-polyclonal-cytokeratin-15-antibody-2442025940240.jpg "Western Blot: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]")
Western Blot: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]
Analysis in human cell lines A-431 and HEK293 using Anti-KRT15 antibody. Corresponding KRT15 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.![Cytokeratin 15 Antibody - BSA Free Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]](https://resources.rndsystems.com/images/products/nbp1-85603_rabbit-polyclonal-cytokeratin-15-antibody-2442025930852.jpg "Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]")
Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]
Immunohistochemistry analysis in human esophagus and liver tissues using HPA023910 antibody. Corresponding KRT15 RNA-seq data are presented for the same tissues.![Cytokeratin 15 Antibody - BSA Free Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]](https://resources.rndsystems.com/images/products/nbp1-85603_rabbit-polyclonal-cytokeratin-15-antibody-2442025930840.jpg "Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]")
Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]
Staining of human esophagus shows strong membranous/cytoplasmic positivity in squamous epithelial cells.Applications for Cytokeratin 15 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 4 using NBP1-85603 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Cytokeratin 15
Long Name
keratin 15
Alternate Names
CK15, CK-15, cytokeratin 15, cytokeratin-15, K15, K15keratin-15, basic, K1CO, keratin 15, keratin, type I cytoskeletal 15, Keratin-15, keratin-15, beta, KRTB, type I cytoskeletal 15
Gene Symbol
KRT15
Additional Cytokeratin 15 Products
Product Documents for Cytokeratin 15 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Cytokeratin 15 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Cytokeratin 15 Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used Cytokeratin 15 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: ImmunocytochemistrySample Tested: Cultured Human KeratinocytesSpecies: HumanVerified Customer | Posted 06/13/2023Overnight incubation at 4ºC with Keratin 15 antibody diluted 1:400 in PBS/BSA 1% Green: Cytokeratin 15 Blue: DAPI
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...