Cytokeratin 4 Antibody (6H9R6)

Novus Biologicals | Catalog # NBP3-15243

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6H9R6 expressed in HEK293
View all Cytokeratin 4 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 4 (P19013). MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytokeratin 4 Antibody (6H9R6)

Western Blot: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Western Blot: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Western Blot: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243] - Western blot analysis of extracts of various cell lines, using Cytokeratin 4 (KRT4) Rabbit mAb (NBP3-15243) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243] - Immunofluorescence analysis of mouse large intestine using Cytokeratin 4 (KRT4) Rabbit mAb (NBP3-15243) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Immunohistochemistry-Paraffin: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Immunohistochemistry-Paraffin: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243] - Immunohistochemistry of paraffin-embedded human lung squamous carcinoma tissue using Cytokeratin 4 (KRT4) Rabbit mAb (NBP3-15243) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243]

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243] - Immunofluorescence analysis of rat rectum using Cytokeratin 4 (KRT4) Rabbit mAb (NBP3-15243) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Cytokeratin 4 Antibody (6H9R6)

Immunocytochemistry/ Immunofluorescence: Cytokeratin 4 Antibody (6H9R6) [Cytokeratin 4] -

Immunocytochemistry/ Immunofluorescence: Cytokeratin 4 Antibody (6H9R6) [Cytokeratin 4] - Confocal imaging of human tonsil tissue using Cytokeratin 4 Rabbit mAb. DAPI was used for nuclear staining (blue). Objective: 40x.Perform high pressure antigen retrieval with 10 mM citrate buffer (pH 6.0) before commencing with IF staining protocol.
Cytokeratin 4 Antibody (6H9R6)

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [Cytokeratin 4] -

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [Cytokeratin 4] - Immunohistochemistry analysis of paraffin-embedded human tonsil tissue using Cytokeratin 4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Cytokeratin 4 Antibody (6H9R6)

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [Cytokeratin 4] -

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [Cytokeratin 4] - Immunohistochemistry analysis of paraffin-embedded human breast tissue using Cytokeratin 4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Cytokeratin 4 Antibody (6H9R6)

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [Cytokeratin 4] -

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [Cytokeratin 4] - Immunohistochemistry analysis of paraffin-embedded human esophagus tissue using Cytokeratin 4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Applications for Cytokeratin 4 Antibody (6H9R6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cytokeratin 4

Keratins are a family of structurally related proteins that form the intermediate filament cytoskeleton in epithelial cells. White sponge nevus (WSN) is a benign autosomal dominant disorder which affects non-cornifying stratified squamous epithelial. Keratins are expressed in pairs by epithelial cells in a tissue and cell specific manner. The major differentiation specific keratins of the buccal mucosa, nasal, esophageal and anogenital epithelia are CK-4 and CK-13. The tissue distribution and nature of the lesions in patients affected by WSN suggested that mutations in CK-4 and/or CK-13 might be responsible for this disorder (1). K4 and K13 form heterodimers in normal epithelial cells. In humans, K4 is present in all layers of the epidermis at 10 weeks and gradually disappears, starting from the basal layers at 15 weeks and becoming totally absent at around 20 weeks. This period corresponds to the early fetal period when melanoblasts derived from the neural crest migrate through the dermis into the basal layer of the epidermis (2)

Alternate Names

CK4, CK-4, CYK4cytokeratin-4, Cytokeratin-4, FLJ31692, K4cytokeratin 4, keratin 4, keratin, type II cytoskeletal 4, Keratin-4, Type-II keratin Kb4

Gene Symbol

KRT4

Additional Cytokeratin 4 Products

Product Documents for Cytokeratin 4 Antibody (6H9R6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cytokeratin 4 Antibody (6H9R6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytokeratin 4 Antibody (6H9R6)

There are currently no reviews for this product. Be the first to review Cytokeratin 4 Antibody (6H9R6) and earn rewards!

Have you used Cytokeratin 4 Antibody (6H9R6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies