Cytokeratin 7 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88080
![Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]](https://resources.rndsystems.com/images/products/Cytokeratin-7-Antibody-Immunohistochemistry-Paraffin-NBP1-88080-img0021.jpg "Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western
Cited:
Western Blot, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Cytokeratin 7 Antibody - BSA Free
![Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]](https://resources.rndsystems.com/images/products/Cytokeratin-7-Antibody-Immunohistochemistry-Paraffin-NBP1-88080-img0017.jpg "Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]")
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human breast shows strong membranous positivity in glandular cells.![Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]](https://resources.rndsystems.com/images/products/Cytokeratin-7-Antibody-Immunohistochemistry-Paraffin-NBP1-88080-img0018.jpg "Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]")
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human lung shows moderate membranous positivity in pneumocytes.![Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]](https://resources.rndsystems.com/images/products/Cytokeratin-7-Antibody-Immunohistochemistry-Paraffin-NBP1-88080-img0019.jpg "Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]")
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.![Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]](https://resources.rndsystems.com/images/products/Cytokeratin-7-Antibody-Immunohistochemistry-Paraffin-NBP1-88080-img0020.jpg "Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]")
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080]
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human skeletal muscle shows no positivity in myocytes as expected.![Simple Western: Cytokeratin 7 Antibody [NBP1-88080]](https://resources.rndsystems.com/images/products/Cytokeratin-7-Antibody-Simple-Western-NBP1-88080-img0007.jpg "Simple Western: Cytokeratin 7 Antibody [NBP1-88080]")
Simple Western: Cytokeratin 7 Antibody [NBP1-88080]
Simple Western: Cytokeratin 7 Antibody [NBP1-88080] - Electropherogram image(s) of corresponding Simple Western lane view. Cytokeratin 7 antibody was used at 1:50 dilution on Tonsil and RT-4 lysate(s).![Simple Western: Cytokeratin 7 Antibody [NBP1-88080]](https://resources.rndsystems.com/images/products/Cytokeratin-7-Antibody-Simple-Western-NBP1-88080-img0006.jpg "Simple Western: Cytokeratin 7 Antibody [NBP1-88080]")
Simple Western: Cytokeratin 7 Antibody [NBP1-88080]
Simple Western: Cytokeratin 7 Antibody [NBP1-88080] - Simple Western lane view shows a specific band for KRT7 in 0.2 mg/ml of Tonsil (left), RT-4 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.![Cytokeratin 7 Antibody - BSA Free Western Blot: Cytokeratin 7 Antibody - BSA Free [NBP1-88080]](https://resources.rndsystems.com/images/products/nbp1-88080_rabbit-polyclonal-cytokeratin-7-antibody-6520251625289.jpg "Western Blot: Cytokeratin 7 Antibody - BSA Free [NBP1-88080]")
![Cytokeratin 7 Antibody - BSA Free Western Blot: Cytokeratin 7 Antibody - BSA Free [NBP1-88080]](https://resources.rndsystems.com/images/products/nbp1-88080_rabbit-polyclonal-cytokeratin-7-antibody-65202516205012.jpg "Western Blot: Cytokeratin 7 Antibody - BSA Free [NBP1-88080]")
Western Blot: Cytokeratin 7 Antibody - BSA Free [NBP1-88080]
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Applications for Cytokeratin 7 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Simple Western
1:50
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in Tonsil, RT-4, separated by Size, antibody dilution of 1:50, apparent MW was 56 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in Tonsil, RT-4, separated by Size, antibody dilution of 1:50, apparent MW was 56 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Cytokeratin 7
Alternate Names
CK-7, CK7, K2C7, K7
Gene Symbol
KRT7
UniProt
Additional Cytokeratin 7 Products
Product Documents for Cytokeratin 7 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Cytokeratin 7 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Cytokeratin 7 Antibody - BSA Free
Powered by Bioz
Customer Reviews for Cytokeratin 7 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Cytokeratin 7 Antibody - BSA Free and earn rewards!
Have you used Cytokeratin 7 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...