DAP Kinase 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38180

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DAP Kinase 1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1141-1430 of human DAP Kinase 1 (DAPK1) (NP_004929.2).

Sequence:
LLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGAPKDFLPSPLHALLREWTTYPESTVGTLMSKLRELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

160 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DAP Kinase 1 Antibody - BSA Free

DAP Kinase 1 Antibody

Western Blot: DAP Kinase 1 Antibody [NBP3-38180] -

Western Blot: DAP Kinase 1 Antibody [NBP3-38180] - Western blot analysis of various lysates using DAP Kinase 1(DAPK1) Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 30s.

Applications for DAP Kinase 1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DAP Kinase 1

DAPK1 (Death-associated protein kinase 1) is a calmodulin dependent serine/threonine serine kinase which functions as a positive mediator of gamma-interferon induced programmed cell death. DAPK1 expression is frequently lost in human carcinomas and B-cell leukemia, and lower levels of expression correlates with high rates of metastasis. The loss of DAPK expression provides a link between suppression of apoptosis and metastasis. DAPK1 is thought be involved in an early apoptotic checkpoint which eliminates premalignant cells from cancer formation. Studies in bladder cancer patients have also shown that hypermethylation of DAPK1 correlates to high recurrence rates and thus DAPK1 may be used as a prognostic marker. DAPK1 is also reportedly a molecular regulator of neuronal death in epilepsy.

Long Name

Death-associated protein kinase 1

Alternate Names

DAPK, DAPK1

Gene Symbol

DAPK1

Additional DAP Kinase 1 Products

Product Documents for DAP Kinase 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DAP Kinase 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DAP Kinase 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DAP Kinase 1 Antibody - BSA Free and earn rewards!

Have you used DAP Kinase 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies