DAZAP2 Antibody (3G21) - Azide and BSA Free

Novus Biologicals | Catalog # H00009802-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 3G21

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

DAZAP2 (NP_055579, 93 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for DAZAP2 Antibody (3G21) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: DAZAP2 Antibody (3G21) [H00009802-M01]

Immunocytochemistry/ Immunofluorescence: DAZAP2 Antibody (3G21) [H00009802-M01]

Immunocytochemistry/Immunofluorescence: DAZAP2 Antibody (3G21) [H00009802-M01] - Analysis of monoclonal antibody to DAZAP2 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: DAZAP2 Antibody (3G21) [H00009802-M01] - Detection limit for recombinant GST tagged DAZAP2 is 0.1 ng/ml as a capture antibody.

Applications for DAZAP2 Antibody (3G21) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is useful for ELISA, Western Blot

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: DAZAP2

DAZAP2, also known as DAZ-associated protein2, consists of five isoforms of sizes 17.3 kDa, 16.1 kDa, 14 kDa, 9 kDa, and 22.8 kDa and is involved in interactions with DAZ proteins and transforming growth factor signaling molecules. This protein is being studied for connection to disorders and diseases such as multiple myeloma, brachydactyly, ataxia, prostatitis, and azoospermia. The protein interacts in pathways including cell signaling, transcription regulation, spermatogenesis, and RNA splicing, which also involve POLI, RHOXF2, BATF2, EXD3, and ZFAND2B proteins.

Alternate Names

DAZ associated protein 2, deleted in azoospermia associated protein 2, Deleted in azoospermia-associated protein 2, KIAA0058DAZ-associated protein 2, MGC14319, MGC766, proline-rich transcript in brain, proline-rich transcript, brain-expressed protein, PRTB

Gene Symbol

DAZAP2

Additional DAZAP2 Products

Product Documents for DAZAP2 Antibody (3G21) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DAZAP2 Antibody (3G21) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DAZAP2 Antibody (3G21) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review DAZAP2 Antibody (3G21) - Azide and BSA Free and earn rewards!

Have you used DAZAP2 Antibody (3G21) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...