DCAF4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91820

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DCAF4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DCAF4 Antibody [NBP1-91820]

Immunocytochemistry/ Immunofluorescence: DCAF4 Antibody [NBP1-91820]

Immunocytochemistry/Immunofluorescence: DCAF4 Antibody [NBP1-91820] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DCAF4 Antibody [NBP1-91820]

Immunohistochemistry-Paraffin: DCAF4 Antibody [NBP1-91820]

Immunohistochemistry-Paraffin: DCAF4 Antibody [NBP1-91820] - Staining of human uterus, pre-menopause shows strong cytoplasmic positivity in glandular cells.
DCAF4 Antibody - BSA Free Immunohistochemistry: DCAF4 Antibody - BSA Free [NBP1-91820]

Immunohistochemistry: DCAF4 Antibody - BSA Free [NBP1-91820]

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
DCAF4 Antibody - BSA Free Immunohistochemistry: DCAF4 Antibody - BSA Free [NBP1-91820]

Immunohistochemistry: DCAF4 Antibody - BSA Free [NBP1-91820]

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
DCAF4 Antibody - BSA Free Immunohistochemistry: DCAF4 Antibody - BSA Free [NBP1-91820]

Immunohistochemistry: DCAF4 Antibody - BSA Free [NBP1-91820]

Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
DCAF4 Antibody - BSA Free Immunohistochemistry: DCAF4 Antibody - BSA Free [NBP1-91820]

Immunohistochemistry: DCAF4 Antibody - BSA Free [NBP1-91820]

Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
DCAF4 Antibody - BSA Free Western Blot: DCAF4 Antibody - BSA Free [NBP1-91820]

Western Blot: DCAF4 Antibody - BSA Free [NBP1-91820]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for DCAF4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DCAF4

DCAF4 encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. [provided by RefSeq]

Alternate Names

DDB1 and CUL4 associated factor 4, DDB1- and CUL4-associated factor 4, DKFZp434K114, MGC20547, MGC46524, WD repeat domain 21, WD repeat domain 21A, WD repeat-containing protein 21A, WDR21, WDR21A

Gene Symbol

DCAF4

Additional DCAF4 Products

Product Documents for DCAF4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DCAF4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DCAF4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DCAF4 Antibody - BSA Free and earn rewards!

Have you used DCAF4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...