DDX17 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38985

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DDX17 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DDX17 Antibody - BSA Free

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-38985]

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-38985]

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-38985] - Staining in human epididymis and skeletal muscle tissues using anti-DDX17 antibody. Corresponding DDX17 RNA-seq data are presented for the same tissues.
Western Blot: DDX17 Antibody [NBP2-38985]

Western Blot: DDX17 Antibody [NBP2-38985]

Western Blot: DDX17 Antibody [NBP2-38985] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: DDX17 Antibody [NBP2-38985]

Immunocytochemistry/ Immunofluorescence: DDX17 Antibody [NBP2-38985]

Immunocytochemistry/Immunofluorescence: DDX17 Antibody [NBP2-38985] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-38985]

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-38985]

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-38985] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-38985]

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-38985]

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-38985] - Staining of human skeletal muscle shows low expression as expected.
DDX17 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: DDX17 Antibody - BSA Free [NBP2-38985]

Chromatin Immunoprecipitation-exo-Seq: DDX17 Antibody - BSA Free [NBP2-38985]

ChIP-Exo-Seq composite graph for Anti-DDX17 (NBP2-38985) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for DDX17 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation

1-10µg per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDX17

DDX17 (p72) is a highly related member of the DEAD box family and is an established RNA helicase. It has been implicated in growth regulation and has been shown to be involved in both pre-mRNA and pre-rRNA processing. This protein has also been reported to act as a transcriptional co-activator for estrogen-receptor alpha (ER ) and shown to interact with co-activators p300/CBP and the RNA polymerase II holoenzyme.

Long Name

DEAD Box Protein 17

Alternate Names

p72, RH70

Gene Symbol

DDX17

UniProt

Q92841

Additional DDX17 Products

Product Documents for DDX17 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DDX17 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX17 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDX17 Antibody - BSA Free and earn rewards!

Have you used DDX17 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies