DDX25 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83328

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DDX25 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVDLAANSLLNKLIHQSLVESSHRVEVLQKDPSSP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DDX25 Antibody - BSA Free

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328]

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328]

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining in human testis and endometrium tissues using anti-DDX25 antibody. Corresponding DDX25 RNA-seq data are presented for the same tissues.
Western Blot: DDX25 Antibody [NBP1-83328]

Western Blot: DDX25 Antibody [NBP1-83328]

Western Blot: DDX25 Antibody [NBP1-83328] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-153
Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328]

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328]

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328]

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328]

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining of human hypothalamus shows strong cytoplasmic positivity in subsets of glial cells and in processes.
Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328]

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328]

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining of human testis shows high expression.

Applications for DDX25 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDX25

DDX25, also known as ATP-dependent RNA helicase DDX25, consists of a 54.7 kDa and a 42 kDa isoform and is involved in regulation of translation and export of mRNA during development of spermatid. The protein has been utilized in current research of diseases and disorders such as pneumonia, malaria, male infertility, and azoospermia. The protein is found in RNA binding pathways in the testis, pituitary, and hypothalamus.

Alternate Names

DEAD (Asp-Glu-Ala-Asp) box polypeptide 25, DEAD box protein 25, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 25, EC 3.6.1, EC 3.6.4.13, Gonadotropin-regulated testicular RNA helicase, GRTHATP-dependent RNA helicase DDX25

Gene Symbol

DDX25

Additional DDX25 Products

Product Documents for DDX25 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DDX25 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX25 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDX25 Antibody - BSA Free and earn rewards!

Have you used DDX25 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies