DDX46 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56227

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DDX46 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DDX46 Antibody - BSA Free

Western Blot: DDX46 Antibody [NBP2-56227]

Western Blot: DDX46 Antibody [NBP2-56227]

Western Blot: DDX46 Antibody [NBP2-56227] - Analysis using Anti-DDX46 antibody NBP2-56227 (A) shows similar pattern to independent antibody NBP1-83565 (B).
Immunocytochemistry/ Immunofluorescence: DDX46 Antibody [NBP2-56227]

Immunocytochemistry/ Immunofluorescence: DDX46 Antibody [NBP2-56227]

Immunocytochemistry/Immunofluorescence: DDX46 Antibody [NBP2-56227] - Staining of human cell line U-251 MG shows localization to nuclear speckles. Antibody staining is shown in green.

Applications for DDX46 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDX46

DDX46 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a component of the 17S U2 snRNP complex; it plays an important role in pre-mRNA splicing.

Alternate Names

DEAD (Asp-Glu-Ala-Asp) box polypeptide 46, DEAD box protein 46, EC 3.6.1, EC 3.6.4.13, FLJ25329, KIAA0801probable ATP-dependent RNA helicase DDX46, MGC9936, Prp5, PRP5 homolog, Prp5-like DEAD-box protein, PRPF5, RNA helicase

Gene Symbol

DDX46

Additional DDX46 Products

Product Documents for DDX46 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DDX46 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX46 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDX46 Antibody - BSA Free and earn rewards!

Have you used DDX46 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies