DDX6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35658

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DDX6 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 384-483aa of human DDX6 (NP_001244120.1).

Sequence:
IQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DDX6 Antibody - BSA Free

DDX6 Antibody

Western Blot: DDX6 Antibody [NBP3-35658] -

Western Blot: DDX6 Antibody [NBP3-35658] - Western blot analysis of various lysates using DDX6 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
DDX6 Antibody

Immunohistochemistry: DDX6 Antibody [NBP3-35658] -

Immunohistochemistry: DDX6 Antibody [NBP3-35658] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using DDX6 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
DDX6 Antibody

Immunocytochemistry/ Immunofluorescence: DDX6 Antibody [NBP3-35658] -

Immunocytochemistry/ Immunofluorescence: DDX6 Antibody [NBP3-35658] - Immunofluorescence analysis of L929 cells using DDX6 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
DDX6 Antibody

Immunohistochemistry: DDX6 Antibody [NBP3-35658] -

Immunohistochemistry: DDX6 Antibody [NBP3-35658] - Immunohistochemistry analysis of paraffin-embedded Rat brain using DDX6 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
DDX6 Antibody

Immunohistochemistry: DDX6 Antibody [NBP3-35658] -

Immunohistochemistry: DDX6 Antibody [NBP3-35658] - Immunohistochemistry analysis of paraffin-embedded Human mammary cancer using DDX6 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for DDX6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DDX6

DDX6 encodes a member of the DEAD box protein family. The protein is an RNA helicase found in P-bodies and stress granules, and functions in translation suppression and mRNA degradation. It is required for microRNA-induced gene silencing.

Alternate Names

ATP-dependent RNA helicase p54, DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, DEAD box protein 6, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD), EC 3.6.1, EC 3.6.4.13, FLJ36338, HLR2DEAD box-6, Oncogene RCK, probable ATP-dependent RNA helicase DDX6, RCKP54

Gene Symbol

DDX6

Additional DDX6 Products

Product Documents for DDX6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DDX6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDX6 Antibody - BSA Free and earn rewards!

Have you used DDX6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies