Dfna5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92914

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Dfna5 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-270 of human Dfna5 (NP_004394.1). MFAKATRNFLREVDADGDLIAVSNLNDSDKLQLLSLVTKKKRFWCWQRPKYQFLSLTLGDVLIEDQFPSPVVVESDFVKYEGKFANHVSGTLETALGKVKLNLGGSSRVESQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGNVTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Dfna5 Antibody - BSA Free

Dfna5 Antibody - Azide and BSA Free

Western Blot: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] -

Western Blot: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] - Western blot analysis of lysates from Jurkat cells using GSDME Rabbit pAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 60s.
Dfna5 Antibody - Azide and BSA Free

Western Blot: Dfna5 Antibody [NBP2-92914] -

Western Blot: Dfna5 Antibody [NBP2-92914] -Analysis of various lysates using GSDME Rabbit pAb at 1:1000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: Dfna5 Antibody - Azide and BSA Free [NBP2-92914]

Immunohistochemistry-Paraffin: Dfna5 Antibody - Azide and BSA Free [NBP2-92914]

Immunohistochemistry-Paraffin: Dfna5 Antibody [NBP2-92914] - Human pancreatic panniculitis using DFNA5/GSDME Rabbit pAb at dilution of 1:50 (40x lens).
Immunohistochemistry-Paraffin: Dfna5 Antibody - Azide and BSA Free [NBP2-92914]

Immunohistochemistry-Paraffin: Dfna5 Antibody - Azide and BSA Free [NBP2-92914]

Immunohistochemistry-Paraffin: Dfna5 Antibody [NBP2-92914] - Human pulmonary tuberculosis using DFNA5/GSDME Rabbit pAb at dilution of 1:50 (40x lens).
Dfna5 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] -

Immunocytochemistry/ Immunofluorescence: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] - Immunofluorescence analysis of NIH/3T3 cells using GSDME Rabbit pAb at dilution of 1:50. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Dfna5 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] -

Immunocytochemistry/ Immunofluorescence: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] - Immunofluorescence analysis of PC-12 cells using GSDME Rabbit pAb at dilution of 1:50. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Dfna5 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] -

Immunocytochemistry/ Immunofluorescence: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] - Immunofluorescence analysis of U2OS cells using GSDME Rabbit pAb at dilution of 1:50. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Dfna5 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Dfna5

Hearing impairment is a heterogeneous condition with over 40 loci described. The protein encoded by this gene is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in this gene. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

deafness, autosomal dominant 5, DFNA5, deafness associated tumor suppressor, gasdermin-E, ICERE1, ICERE-1, Inversely correlated with estrogen receptor expression 1, nonsyndromic hearing impairment protein, non-syndromic hearing impairment protein 5

Gene Symbol

GSDME

Additional Dfna5 Products

Product Documents for Dfna5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Dfna5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dfna5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dfna5 Antibody - BSA Free and earn rewards!

Have you used Dfna5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies