DHRS13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81163

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DHRS13 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPEIQLS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DHRS13 Antibody - BSA Free

Western Blot: DHRS13 Antibody [NBP1-81163]

Western Blot: DHRS13 Antibody [NBP1-81163]

Western Blot: DHRS13 Antibody [NBP1-81163] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: DHRS13 Antibody [NBP1-81163]

Immunocytochemistry/ Immunofluorescence: DHRS13 Antibody [NBP1-81163]

Immunocytochemistry/Immunofluorescence: DHRS13 Antibody [NBP1-81163] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: DHRS13 Antibody [NBP1-81163]

Immunohistochemistry-Paraffin: DHRS13 Antibody [NBP1-81163]

Immunohistochemistry-Paraffin: DHRS13 Antibody [NBP1-81163] - Staining of human cerebellum shows strong nuclear and cytoplasmic positivity in purkinje cells.

Applications for DHRS13 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DHRS13

DHRS13, also known as Dehydrogenase/reductase SDR family member 13, is a 41kDa 377 amino acid protein. DHRS13 is secreted and is a putative oxidoreductase. Research on DHRS13 has been stuided in relation to retinitis, tuberculosis and mycobacterium tuberculosis.

Alternate Names

dehydrogenase/reductase (SDR family) member 13, dehydrogenase/reductase SDR family member 13, EC 1.1, MGC23280, SDR7C5, short chain dehydrogenase/reductase family 7C, member 5

Entrez Gene IDs

147015 (Human)

Gene Symbol

DHRS13

Additional DHRS13 Products

Product Documents for DHRS13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DHRS13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DHRS13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DHRS13 Antibody - BSA Free and earn rewards!

Have you used DHRS13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies