DHX15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13919

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: RASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DHX15 Antibody - BSA Free

Western Blot: DHX15 Antibody [NBP2-13919]

Western Blot: DHX15 Antibody [NBP2-13919]

Western Blot: DHX15 Antibody [NBP2-13919] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: DHX15 Antibody [NBP2-13919]

Immunocytochemistry/ Immunofluorescence: DHX15 Antibody [NBP2-13919]

Immunocytochemistry/Immunofluorescence: DHX15 Antibody [NBP2-13919] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DHX15 Antibody [NBP2-13919]

Immunohistochemistry-Paraffin: DHX15 Antibody [NBP2-13919]

Immunohistochemistry-Paraffin: DHX15 Antibody [NBP2-13919] - Staining of human rectum shows moderate nuclear positivity in glandular cells.
Western Blot: DHX15 Antibody [NBP2-13919]

Western Blot: DHX15 Antibody [NBP2-13919]

Western Blot: DHX15 Antibody [NBP2-13919] - Analysis in human cell line RT-4.
Immunohistochemistry-Paraffin: DHX15 Antibody [NBP2-13919]

Immunohistochemistry-Paraffin: DHX15 Antibody [NBP2-13919]

Immunohistochemistry-Paraffin: DHX15 Antibody [NBP2-13919] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: DHX15 Antibody [NBP2-13919]

Immunohistochemistry-Paraffin: DHX15 Antibody [NBP2-13919]

Immunohistochemistry-Paraffin: DHX15 Antibody [NBP2-13919] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: DHX15 Antibody [NBP2-13919]

Immunohistochemistry-Paraffin: DHX15 Antibody [NBP2-13919]

Immunohistochemistry-Paraffin: DHX15 Antibody [NBP2-13919] - Staining of human testis shows weak nuclear positivity in cells in seminiferous ducts and in Leydig cells.

Applications for DHX15 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DHX15

The protein encoded by the DHX15 gene is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing. (provided by RefSeq)

Alternate Names

ATP-dependent RNA helicase #46, DBP1DEAH box protein 15, DDX15putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 15, DEAH (Asp-Glu-Ala-His) box polypeptide 15, EC 3.6.1, EC 3.6.4.13, HRH2DEAD/H box-15, PRP43, PRPF43, PrPp43p, RNA helicase 2

Gene Symbol

DHX15

Additional DHX15 Products

Product Documents for DHX15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DHX15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DHX15 Antibody - BSA Free

Customer Reviews for DHX15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DHX15 Antibody - BSA Free and earn rewards!

Have you used DHX15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...