Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)
Novus Biologicals | Catalog # NBP3-16595
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 3J2O9 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 401-500 of human Dihydrolipoamide Dehydrogenase/DLD (P09622). WVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLA
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595]
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Western blot analysis of extracts of various cell lines, using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb (NBP3-16595) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.Immunocytochemistry/ Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595]
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunofluorescence analysis of U-2 OS cells using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb (NBP3-16595) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -
Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human colon carcinoma tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -
Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded rat spleen tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -
Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human liver tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -
Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human kidney tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -
Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human esophagus tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -
Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded mouse kidney tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -
Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human tonsil tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Applications for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Dihydrolipoamide Dehydrogenase/DLD
Alternate Names
Diaphorase, DLD, DLDD, DLDH, GCSL, LAD, Lipoamide Dehydrogenase, PHE3
Gene Symbol
DLD
Additional Dihydrolipoamide Dehydrogenase/DLD Products
Product Documents for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)
There are currently no reviews for this product. Be the first to review Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) and earn rewards!
Have you used Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...