Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Novus Biologicals | Catalog # NBP3-16595

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3J2O9 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 401-500 of human Dihydrolipoamide Dehydrogenase/DLD (P09622). WVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595]

Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595]

Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Western blot analysis of extracts of various cell lines, using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb (NBP3-16595) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595]

Immunocytochemistry/ Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595]

Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunofluorescence analysis of U-2 OS cells using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb (NBP3-16595) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human colon carcinoma tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded rat spleen tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human liver tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human kidney tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human esophagus tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded mouse kidney tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] -

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human tonsil tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Dihydrolipoamide Dehydrogenase/DLD

Lipoamide Dehydrogenase encodes the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.

Alternate Names

Diaphorase, DLD, DLDD, DLDH, GCSL, LAD, Lipoamide Dehydrogenase, PHE3

Gene Symbol

DLD

Additional Dihydrolipoamide Dehydrogenase/DLD Products

Product Documents for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

There are currently no reviews for this product. Be the first to review Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) and earn rewards!

Have you used Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...