DKC1 Antibody (2W2V6)

Novus Biologicals | Catalog # NBP3-16405

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2W2V6 expressed in HEK293
View all DKC1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 300-400 of human DKC1 (O60832). VMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DKC1 Antibody (2W2V6)

Western Blot: DKC1 Antibody (2W2V6) [NBP3-16405]

Western Blot: DKC1 Antibody (2W2V6) [NBP3-16405]

Western Blot: DKC1 Antibody (2W2V6) [NBP3-16405] - Western blot analysis of extracts of PC-3 cells, using DKC1 Rabbit mAb (NBP3-16405) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: DKC1 Antibody (2W2V6) [NBP3-16405]

Western Blot: DKC1 Antibody (2W2V6) [NBP3-16405]

Western Blot: DKC1 Antibody (2W2V6) [NBP3-16405] - Western blot analysis of extracts of various cell lines, using DKC1 Rabbit mAb (NBP3-16405) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
DKC1 Antibody (2W2V6)

Immunohistochemistry: DKC1 Antibody (2W2V6) [NBP3-16405] -

Immunohistochemistry: DKC1 Antibody (2W2V6) [NBP3-16405] - Immunohistochemistry analysis of DKC1 in paraffin-embedded human cervix cancer tissue using DKC1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
DKC1 Antibody (2W2V6)

Immunohistochemistry: DKC1 Antibody (2W2V6) [NBP3-16405] -

Immunohistochemistry: DKC1 Antibody (2W2V6) [NBP3-16405] - Immunohistochemistry analysis of DKC1 in paraffin-embedded mouse brain tissue using DKC1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
DKC1 Antibody (2W2V6)

Immunohistochemistry: DKC1 Antibody (2W2V6) [NBP3-16405] -

Immunohistochemistry: DKC1 Antibody (2W2V6) [NBP3-16405] - Immunohistochemistry analysis of DKC1 in paraffin-embedded mouse colon tissue using DKC1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for DKC1 Antibody (2W2V6)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DKC1

DKC1 is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the NOLA1, 2 and 3 proteins. The protein encoded by this gene and the three NOLA proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The protein encoded by this gene is related to the Saccharomyces cerevisiae Cbf5p and Drosophila melanogaster Nop60B proteins. The gene lies in a tail-to-tail orientation with the palmitoylated erythrocyte membrane protein gene and is transcribed in a telomere to centromere direction. Both nucleotide substitutions and single trinucleotide repeat polymorphisms have been found in this gene. Mutations in this gene cause X-linked dyskeratosis congenita, a disease resulting in reticulate skin pigmentation, mucosal leukoplakia, nail dystrophy, and progressive bone marrow failure in most cases. Mutations in this gene also cause Hoyeraal-Hreidarsson syndrome, which is a more severe form of dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

CBF5, CBF5 homolog, cbf5p homolog, DKC, dyskeratosis congenita 1, dyskerin, Dyskerin, EC 5.4.99, EC 5.4.99.-, FLJ97620, H/ACA ribonucleoprotein complex subunit 4, NAP57, NOLA4dyskerin, Nopp140-associated protein of 57 kDa, Nucleolar protein family A member 4, Nucleolar protein NAP57, snoRNP protein DKC1, XAP101

Gene Symbol

DKC1

Additional DKC1 Products

Product Documents for DKC1 Antibody (2W2V6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DKC1 Antibody (2W2V6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DKC1 Antibody (2W2V6)

Customer Reviews for DKC1 Antibody (2W2V6)

There are currently no reviews for this product. Be the first to review DKC1 Antibody (2W2V6) and earn rewards!

Have you used DKC1 Antibody (2W2V6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies