DLG7/HURP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35362

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 547-846 of human DLG7/HURP (NP_055565.3).

Sequence:
KNVFRKKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPVKLFSGLSVSSEGPSQRLGTPKSVNKAVSQSRNEMGIPQQTTSPENAGPQNTKSEHVKKTLFLSIPESRSSIEDAQCPGLPDLIEENHVVNKTDLKVDCLSSERMSLPLLAGGVADDINTNKKEGISDVVEGMELNSSITSQDVLMSSPEKNTASQNSILEEGETKISQSELFDNKSLTTECHLLDSPGLNCSNPFTQLERRHQEHARHISFGGNLITFSPLQPGEF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DLG7/HURP Antibody - BSA Free

DLG7/HURP Antibody

Immunocytochemistry/ Immunofluorescence: DLG7/HURP Antibody [NBP3-35362] -

Immunocytochemistry/ Immunofluorescence: DLG7/HURP Antibody [NBP3-35362] - Immunofluorescence analysis of HeLa cells using DLG7/HURP Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
DLG7/HURP Antibody

Western Blot: DLG7/HURP Antibody [NBP3-35362] -

Western Blot: DLG7/HURP Antibody [NBP3-35362] - Western blot analysis of various lysates using DLG7/HURP Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for DLG7/HURP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DLG7/HURP

DLG7/HURP is a novel component of the Ran-importin spindle assembly pathway. DLG7/HURP binds microtubules and affects their organization both in vitro and in vivo. In egg extract, anti-DLG7/HURP antibodies disrupt the formation of both Ran-dependent and chromatin and centrosome-induced spindles. DLG7/HURP is also required for the proper formation and function of mitotic spindles in HeLa cells. DLG7/HURP is also over-expressed in some tumor types

Alternate Names

DAP-5, Discs large homolog 7, discs, large (Drosophila) homolog-associated protein 5, disks large-associated protein 5, DLG7, Hepatoma up-regulated protein, HURPDLG1, KIAA0008discs, large homolog 7 (Drosophila), large homolog 7

Gene Symbol

DLGAP5

Additional DLG7/HURP Products

Product Documents for DLG7/HURP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DLG7/HURP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DLG7/HURP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DLG7/HURP Antibody - BSA Free and earn rewards!

Have you used DLG7/HURP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...