DNA Polymerase epsilon subunit 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13785

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DNA Polymerase epsilon subunit 3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNA Polymerase epsilon subunit 3 Antibody - BSA Free

Western Blot: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785]

Western Blot: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785]

Western Blot: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785]

Immunocytochemistry/ Immunofluorescence: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785]

Immunocytochemistry/Immunofluorescence: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785]

Immunohistochemistry-Paraffin: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785]

Immunohistochemistry-Paraffin: DNA Polymerase epsilon subunit 3 Antibody [NBP2-13785] - Staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.

Applications for DNA Polymerase epsilon subunit 3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNA Polymerase epsilon subunit 3

DNA polymerase epsilon (POLE) is an enzyme that helps catalyze in the polymerization of deoxyribonucleotides into a DNA strand. The C-terminus of DNA polymerase E subunit complexes with subunits B and C, whereas the N-terminal domain contains an active polymerase domain.

DNA Pol E antibodies are useful for DNA replication and repair studies and in research on mitosis and cell replication.

Alternate Names

Arsenic-transactivated protein, AsTP, CHARAC17arsenic transactivated protein, CHRAC-17, CHRAC17Ybl1, Chromatin accessibility complex 17 kDa protein, DNA polymerase epsilon p17 subunit, DNA polymerase epsilon subunit 3, DNA polymerase epsilon subunit p17, DNA polymerase II subunit 3, EC 2.7.7.7, histone fold protein CHRAC17, HuCHRAC17, p17, polymerase (DNA directed), epsilon 3 (p17 subunit), YBL1

Gene Symbol

POLE3

Additional DNA Polymerase epsilon subunit 3 Products

Product Documents for DNA Polymerase epsilon subunit 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DNA Polymerase epsilon subunit 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNA Polymerase epsilon subunit 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNA Polymerase epsilon subunit 3 Antibody - BSA Free and earn rewards!

Have you used DNA Polymerase epsilon subunit 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies