DRP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34205

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DRP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE

Reactivity Notes

Rat (85%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DRP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205]

Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205]

Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining in human cerebral cortex and pancreas tissues.. Corresponding DNM1L RNA-seq data are presented for the same tissues.
Western Blot: DRP1 Antibody [NBP2-34205]

Western Blot: DRP1 Antibody [NBP2-34205]

Western Blot: DRP1 Antibody [NBP2-34205] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: DRP1 Antibody [NBP2-34205]

Immunocytochemistry/ Immunofluorescence: DRP1 Antibody [NBP2-34205]

Immunocytochemistry/Immunofluorescence: DRP1 Antibody [NBP2-34205] - Staining of human cell line U-251 MG shows localization to cytosol and vesicles.
Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205]

Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205]

Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205]

Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205]

Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205]

Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205]

Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Applications for DRP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DRP1

DRP1 is a member of the dynamin GTPase superfamily, which that contributes to mitochondrial division in mammalian cells. DRP1 plays this important role in mitochondrial fission at steady state and during apoptosis. DRP1 is required for proper cellular distribution of mitochondria, and in mutant neurons, mitochondria are largely absent from synapses. Therefore, DRP1 provides a genetic tool to assess the role of mitochondria at synapses.

The DRP1 gene has 3 alternatively spliced transcripts encoding different isoforms, which are alternatively polyadenylated.

Long Name

Dynamin-1-like protein

Alternate Names

DLP1, DNM1L, DVLP, Dymple, HdynIV

Gene Symbol

DNM1L

UniProt

O00429 (Human)

Additional DRP1 Products

Product Documents for DRP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DRP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DRP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DRP1 Antibody - BSA Free and earn rewards!

Have you used DRP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies