dUTPase Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33277

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all dUTPase Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit dUTPase Antibody - BSA Free (NBP2-33277) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for dUTPase Antibody - BSA Free

Western Blot: dUTPase Antibody [NBP2-33277]

Western Blot: dUTPase Antibody [NBP2-33277]

Western Blot: dUTPase Antibody [NBP2-33277] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: dUTPase Antibody [NBP2-33277]

Immunocytochemistry/ Immunofluorescence: dUTPase Antibody [NBP2-33277]

Immunocytochemistry/Immunofluorescence: dUTPase Antibody [NBP2-33277] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277]

Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277]

Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277] - Staining in human lymph node and skeletal muscle tissues using anti-DUT antibody. Corresponding DUT RNA-seq data are presented for the same tissues.
Immunohistochemistry: dUTPase Antibody [NBP2-33277]

Immunohistochemistry: dUTPase Antibody [NBP2-33277]

Immunohistochemistry: dUTPase Antibody [NBP2-33277] - Staining of human tonsil shows strong cytoplasmic and nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277]

Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277]

Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277] - Staining of liver.
Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277]

Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277]

Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277] - Staining of liver cancer.
Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277]

Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277]

Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277]

Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277]

Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277] - Staining of human skeletal muscle shows low expression as expected.

Applications for dUTPase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: dUTPase

dUTPase encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19.

Alternate Names

deoxyuridine triphosphatase, dUTP pyrophosphatasedUTP nucleotidohydrolase, dUTPasedeoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial, EC 3.6.1.23, FLJ20622

Gene Symbol

DUT

UniProt

P33316 (Human)

Additional dUTPase Products

Product Documents for dUTPase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for dUTPase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for dUTPase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review dUTPase Antibody - BSA Free and earn rewards!

Have you used dUTPase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies